4YFS: Duffy receptor

Structure of the synthetic Duffy Binding Protein (DBP) antigen DEKnull relevant for malaria vaccine design. Determined by X-ray diffraction at 2.1 Å resolution. Released 11 Mar 2015.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Plasmodium vivax
Chains: 1
Atoms: 2,520
Mol. weight: 38.26 kDa
Released: 11 Mar 2015

Explore 4YFS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4YFS contains 17 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	16	1	1
β-strand	25	1	1
α-helix	27-30	4
α-helix	35-38	4
α-helix	52-77	26
α-helix	84-102	19
α-helix	111-123	13
α-helix	129-148	20
α-helix	150-156	7
α-helix	157-162	6
α-helix	166-170	5
α-helix	175-202	28
α-helix	212-214	3
α-helix	217-250	34
α-helix	254-255	2
α-helix	261-268	8
α-helix	274-281	8
α-helix	286-292	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Duffy receptor	A	protein	326	Plasmodium vivax	P22290 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4YFS_1 Duffy receptor (chains A)
MGTISSAIINHAFLQNTVMKNCNYKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNLVN
NTDTNFHRDITFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIM
GTDMEGIGYSKVVENNLRSIFGTASTAATSRTSWWNESKAQIWTAMMYSVKKRLKGNFIW
ICKLNVAVNIEPQIYRWIREWGRDYVSELPTEVQKLKEKCDGKINYTDKKVCKVPPCQNA
CKSYDQWITRKKNQWDVLSNKFISVKNAEKVQTAGIVTPYDILKQELDEFNEVAFENEIN
KRDGAYIELCVCSVEEAKKNTQEVVT

Primary citation

Structural Analysis of the Synthetic Duffy Binding Protein (DBP) Antigen DEKnull Relevant for Plasmodium vivax Malaria Vaccine Design. Chen, E., Salinas, N.D., Ntumngia, F.B. et al. PLoS Negl Trop Dis (2015) 9:e0003644-e0003644. DOI 10.1371/journal.pntd.0003644 · PubMed

Other PDB entries of the same protein (UniProt P22290 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9EZE 1.55 Å, Structure of subdomain 3 of the Plasmodium vivx Duffy binding protein (PvDBP) bound to…
3RRC 1.95 Å, Crystal Structure of Region II from Plasmodium vivax Duffy Binding Protein
4NUU 1.95 Å, Heterotrimer structure of Region II from Plasmodium vivax Duffy Binding Protein (PvDBP)…
8A44 2.49 Å, Plasmodium vivax Duffy binding protein region II bound the DARC ectodomain and…
4NUV 2.6 Å, Heterotetramer structure of Region II from Plasmodium vivax Duffy Binding Protein…
6OAN 2.9 Å, Structure of DBP in complex with human neutralizing antibody 053054
6R2S 3.04 Å, The structure of Plasmodium vivax Duffy binding protein (PvDBP) bound to human antibody…
6OAO 3.5 Å, Structure of DBP in complex with human neutralizing antibody 092096
5F3J 4.0 Å, Crystal structure of DBP in complex with inhibitory monoclonal antibody 2D10

Browse structure collections

About this viewer

MolViewer shows 4YFS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.