4YI0: Mouse importin a1

Structure of mouse importin a1 bound to Pom121NLS. Determined by X-ray diffraction at 1.81 Å resolution. Released 13 Jan 2016.

Method: X-ray diffraction
Resolution: 1.81 Å
Organisms: Mus musculus, Rattus norvegicus
Chains: 2
Atoms: 4,053
Mol. weight: 53.53 kDa
Released: 13 Jan 2016

Explore 4YI0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4YI0 contains 35 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	315-317	3

Chain C: 34 helices, 0 β-strands

Element	Residues	Length
α-helix	78-85	8
α-helix	90-104	15
α-helix	112-117	6
α-helix	121-127	7
α-helix	134-148	15
α-helix	152-160	9
α-helix	163-170	8
α-helix	176-190	15
α-helix	194-202	9
α-helix	206-212	7
α-helix	218-220	3
α-helix	223-237	15
α-helix	243-245	3
α-helix	246-259	14
α-helix	265-278	14
α-helix	283-290	8
α-helix	295-302	8
α-helix	307-320	14
α-helix	325-333	9
α-helix	336-339	4
α-helix	340-343	4
α-helix	349-362	14
α-helix	367-375	9
α-helix	378-387	10
α-helix	391-407	17
α-helix	410-418	9
α-helix	422-427	6
α-helix	428-430	3
α-helix	434-453	20
α-helix	457-466	10
α-helix	469-475	7
α-helix	476-478	3
α-helix	482-491	10
α-helix	492-496	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit alpha-1	C	protein	460	Mus musculus	P52293 (AlphaFold model)
Nuclear envelope pore membrane protein POM 121	A	protein	30	Rattus norvegicus	P52591 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>4YI0_1 Importin subunit alpha-1 (chains C)
NQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG
KTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI
AGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAV
EQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPI
VTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ
IQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLL
SAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASL
NLIEKYFSVEEEEDQNVVPETTSEGFAFQVQDGAPGTFNF

Sequence of entity 2 (A), FASTA

>4YI0_2 Nuclear envelope pore membrane protein POM 121 (chains A)
LKEKKKRTVAEEDQLHLDGQENKRRRHDSS

Primary citation

Mammalian Pom121 and yeast Heh2 share IBB-like NLSs that support targeting to the inner nuclear membrane. Kralt, A., Basheer, N.J., van den Boom, V. et al. To be published.

Other PDB entries of the same protein (UniProt P52293 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UAF 1.7 Å, Importin alpha 1 delta IBB in complex with Influenza PB2 nuclear localization domain
5CTT 1.7 Å, Crystal structure of human SART3/TIP110 NLS-mouse importin alpha complex
6IUA 1.7 Å, Crystal structure of importin-alpha1 bound to the 53BP1 nuclear localization signal…
6K06 1.75 Å, Crystal structure of Importin-alpha and phosphomimetic GM130
8HE0 1.8 Å, Crystal structure of importin-alpha1 bound to the HIF-1alpha nuclear localization signal…
7RG1 1.85 Å, Importin alpha2 in complex with MERS ORF4B H26A mutant
4MZ6 1.88 Å, Structure of importin-alpha: dUTPase S11E NLS mutant complex
3UL1 1.9 Å, Mouse importin alpha: nucleoplasmin cNLS peptide complex
5D5K 1.9 Å, Crystal Structure NLS from human PARP-2 complexed with Importin alpha delta IBB
5UMZ 1.9 Å, Structure of TNRC6A NLS in complex with importin-alpha
6IU7 1.9 Å, Crystal structure of importin-alpha1 bound to the 53BP1 nuclear localization signal…
8FUA 1.9 Å, Crystal structure of mouse Importin alpha in complex with Hendra virus matrix protein NLS1

Browse structure collections

About this viewer

MolViewer shows 4YI0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.