CW-type zinc finger of ZCWPW2 with F78D mutation. Determined by X-ray diffraction at 1.57 Å resolution. Released 8 Apr 2015.
Explore 4Z0O in 3D Show helices and sheets RCSB PDB PDBe
4Z0O contains 3 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28-32 | 5 | 1 |
| β-strand | 41-45 | 5 | 1 |
| α-helix | 46-50 | 5 | |
| α-helix | 60-62 | 3 | |
| α-helix | 74-76 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Zinc finger CW-type PWWP domain protein 2 | A | protein | 59 | Homo sapiens | Q504Y3 (AlphaFold model) |
>4Z0O_1 Zinc finger CW-type PWWP domain protein 2 (chains A) GVENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEEDD
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (UNX, NA) are not listed.
CW-type zinc finger of ZCWPW2 with F78D mutation. Liu, Y., Tempel, W., Bountra, C. et al. To be published.
Other PDB entries of the same protein (UniProt Q504Y3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4Z0O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.