4Z0R: CW domain of ZCWPW2 mutant F78R

Crystal Structure of the CW domain of ZCWPW2 mutant F78R in complex with histone H3 peptide. Determined by X-ray diffraction at 1.75 Å resolution. Released 8 Apr 2015.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,712
Mol. weight: 23.23 kDa
Ligands: ZN
Released: 8 Apr 2015

Explore 4Z0R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4Z0R contains 12 α-helices and 9 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	28	1	1
β-strand	30-32	3	2
β-strand	41-43	3	2
α-helix	44-45	2
α-helix	46-51	6
α-helix	60-62	3
α-helix	74-77	4

Chain B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	26	1
β-strand	27-32	6	3
β-strand	41-43	3	3
α-helix	46-51	6
α-helix	60-62	3
α-helix	74-77	4

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-9	7	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Zinc finger CW-type PWWP domain protein 2	A, B, C	protein	59	Homo sapiens	Q504Y3 (AlphaFold model)
Histone H3.1	D	protein	16	Homo sapiens	P68431 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>4Z0R_1 Zinc finger CW-type PWWP domain protein 2 (chains A, B, C)
GVENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEEDR

Sequence of entity 2 (D), FASTA

>4Z0R_2 Histone H3.1 (chains D)
ARTKQTARKSTGGKAX

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Water and common crystallization additives (SO4, UNX, EDO) are not listed.

Primary citation

Crystal Structure of the CW domain of ZCWPW2 mutant F78R in complex with histone H3 peptide. Liu, Y., Tempel, W., Bountra, C. et al. To be published.

Other PDB entries of the same protein (UniProt Q504Y3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Z0O 1.57 Å, CW-type zinc finger of ZCWPW2 with F78D mutation
4O62 1.78 Å, CW-type zinc finger of ZCWPW2 in complex with the amino terminus of histone H3

Browse structure collections

About this viewer

MolViewer shows 4Z0R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.