4ZDH: JKA6 TCR

Crystal structure of JKA6 TCR. Determined by X-ray diffraction at 2.1 Å resolution. Released 4 May 2016.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,641
Mol. weight: 49.66 kDa
Released: 4 May 2016

Explore 4ZDH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ZDH contains 17 α-helices and 41 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	1
β-strand	12-15	4	2
α-helix	19	1
β-strand	20-26	7	1
β-strand	34-39	6	2
β-strand	46-51	6	2
β-strand	55-59	5	1
β-strand	62-67	6	1
β-strand	72-77	6	1
α-helix	82-84	3
β-strand	86-93	8	2
β-strand	100-102	3	2
β-strand	106-111	6	2
α-helix	112	1
β-strand	120-126	7	3
β-strand	133-138	6	3
α-helix	147-149	3
β-strand	154-156	3	3
α-helix	157-159	3
β-strand	160-164	5	3
α-helix	165-167	3
β-strand	169-178	10	3
α-helix	185-187	3
α-helix	193-195	3
β-strand	199	1	3
α-helix	201-203	3

Chain B: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	4
β-strand	10-14	5	5
β-strand	19-25	7	4
β-strand	31-38	8	5
β-strand	42-49	8	5
β-strand	56-57	2	5
β-strand	64-70	7	4
β-strand	73-78	6	4
α-helix	83-85	3
β-strand	87-94	8	5
β-strand	103-104	2	5
β-strand	108-113	6	5
α-helix	116-118	3
β-strand	120	1	6
α-helix	121-122	2
β-strand	123-128	6	3
α-helix	129-130	2
α-helix	131-137	7
β-strand	139-149	11	3
β-strand	150	1	6
β-strand	154-160	7	7
β-strand	163-165	3	7
β-strand	169-171	3	3
α-helix	175	1
β-strand	176-177	2	3
β-strand	187-196	10	3
α-helix	197-200	4
β-strand	206-213	8	7
β-strand	216	1	8
α-helix	227-228	2
β-strand	230	1	8
β-strand	232-239	8	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha chain of A6 T-cell receptor,T-cell receptor alpha chain C region	A	protein	201	Homo sapiens	A0A075B6T6 (AlphaFold model), P01848 (AlphaFold model)
Beta chain of JKF6 T-cell receptor,Protein TRBV28	B	protein	241	Homo sapiens	A0A5B6 (AlphaFold model), P01850 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4ZDH_1 Alpha chain of A6 T-cell receptor,T-cell receptor alpha chain C region (chains A)
EVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMSIYSNGDKEDGRFT
AQLNKASQYVSLLIRDAQPSDSATYLCAVTTDSWGKLQFGAGTQVVVTPDIQNPDPAVYQ
LRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDF
ACANAFNNSIIPEDTFFPSPE

Sequence of entity 2 (B), FASTA

>4ZDH_2 Beta chain of JKF6 T-cell receptor,Protein TRBV28 (chains B)
KVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPE
GYSVSREKKERFSLILASASTDQTSMYLCASSFLGTGVEQYFGPGTRLTVVEDLNKVFPP
EVALFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPAL
NDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSEADEWTQARAKPVTQIVSAEAWGRA
D

Primary citation

Crystal structure of JKA6 TCR. Singh, N.K., Hossain, M., Baker, B.M. To be published.

Other PDB entries of the same protein (UniProt A0A075B6T6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8RLT 2.25 Å, TCR in complex with HLA-E*01:03 bound to HBV envelope 371-379 index peptide
8RLU 2.35 Å, TCR in complex with HLA-E*01:03 bound to HBV envelope 371-379 S3N peptide
5E9D 2.51 Å, RD-1 Mart-1 High bound to Mart-1 decameric peptide (ELA) in complex with HLA-A2
1AO7 2.6 Å, Complex between human T-cell receptor, viral peptide (TAX), and HLA-a 0201
8RLV 2.61 Å, TCR in complex with HLA-E*01:03 bound to HBV envelope 371-379 L6I peptide
6DKP 2.97 Å, The complex among DMF5(alpha-D26Y, alpha-Y50A,beta-L98W) TCR, human Class I MHC HLA-A2…
5NHT 3.2 Å, human 199.54-16 TCR in complex with Melan-A/MART-1 (26-35) peptide and HLA-A2

Browse structure collections

About this viewer

MolViewer shows 4ZDH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.