4ZGI: Truncated Human TIFA

Structure of Truncated Human TIFA. Determined by X-ray diffraction at 2.7 Å resolution. Released 14 Oct 2015.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,163
Mol. weight: 16.72 kDa
Released: 14 Oct 2015

Explore 4ZGI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ZGI contains 4 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	12-13	2
β-strand	14-21	8	1
α-helix	23-26	4
β-strand	38-42	5	1
β-strand	47-50	4	2
β-strand	58-59	2	2
β-strand	70-76	7	2
α-helix	77	1
β-strand	83-89	7	2
α-helix	95	1
β-strand	96-98	3	1
β-strand	101-103	3	1
β-strand	108-110	3	2
β-strand	114-119	6	1
β-strand	122-129	8	1
β-strand	136-143	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TRAF-interacting protein with FHA domain-containing protein A	A	protein	140	Homo sapiens	Q96CG3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4ZGI_1 TRAF-interacting protein with FHA domain-containing protein A (chains A)
EETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQ
FSLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKE
DGESLEFFETQFILSPRSLL

Primary citation

Uncovering the Mechanism of Forkhead-Associated Domain-Mediated TIFA Oligomerization That Plays a Central Role in Immune Responses. Weng, J.H., Hsieh, Y.C., Huang, C.C. et al. Biochemistry (2015) 54:6219-6229. DOI 10.1021/acs.biochem.5b00500 · PubMed

Other PDB entries of the same protein (UniProt Q96CG3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6A33 2.1 Å, Binding and Enhanced Binding between Key Immunity Proteins TRAF6 and TIFA
5ZUJ 2.6 Å, Binding and Enhanced Binding between Key Immunity Proteins TRAF6 and TIFA
4YM4 3.12 Å, Truncated Human TIFA in complex with its Thr9 phosphorylated N-terminal peptide 1-15

Browse structure collections

About this viewer

MolViewer shows 4ZGI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.