4ZK1: Lymnaea stagnalis Acetylcholine-Binding Protein

Crystal Structure of Lymnaea stagnalis Acetylcholine-Binding Protein (LsAChBP) in Complex with 3-Pyrrolylmethylene Anabaseine. Determined by X-ray diffraction at 1.75 Å resolution. Released 13 May 2015.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Lymnaea stagnalis
Chains: 10
Atoms: 17,455
Mol. weight: 251.92 kDa
Ligands: 4P7, PO4
Released: 13 May 2015

Explore 4ZK1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ZK1 contains 33 α-helices and 140 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and F: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	0-13	14
β-strand	22	1	1
β-strand	25	1	1
β-strand	27-42	16	2
β-strand	47-59	13	2
α-helix	61-63	3
β-strand	73-77	5	2
α-helix	78-80	3
β-strand	86-88	3	3
β-strand	91	1	2
β-strand	96-97	2	2
β-strand	102-106	5	2
β-strand	110-113	4	2
β-strand	116-122	7	2
β-strand	134-142	9	3
β-strand	150-153	4	2
β-strand	171-184	14	3
β-strand	191-203	13	3

Chains B and G: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	0-13	14
β-strand	27-42	16	4
β-strand	47-59	13	4
α-helix	61-63	3
β-strand	73-77	5	4
α-helix	78-80	3
β-strand	86-88	3	4
β-strand	91	1	4
β-strand	96-97	2	4
β-strand	102-106	5	4
β-strand	110-113	4	4
β-strand	116-122	7	4
β-strand	134-142	9	4
β-strand	150-154	5	4
β-strand	158-159	2	4
β-strand	171-184	14	4
β-strand	191-203	13	4

Chain C: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	0-13	14
β-strand	22	1	5
β-strand	25	1	5
β-strand	27-42	16	6
β-strand	47-59	13	6
α-helix	61-63	3
β-strand	73-77	5	6
α-helix	78-80	3
β-strand	86-88	3	7
β-strand	96-97	2	6
β-strand	102-106	5	6
β-strand	110-113	4	6
β-strand	116-122	7	6
β-strand	124	1	7
β-strand	134-142	9	7
β-strand	150-154	5	6
β-strand	171-184	14	7
β-strand	191-203	13	7

Chain D: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	0-13	14
α-helix	26	1
β-strand	27-42	16	8
β-strand	47-59	13	8
α-helix	61-63	3
β-strand	73-77	5	8
α-helix	78-80	3
β-strand	86-88	3	9
β-strand	91	1	8
β-strand	96-97	2	8
β-strand	102-106	5	8
β-strand	110-113	4	8
β-strand	116-122	7	8
β-strand	134-142	9	9
β-strand	150-153	4	8
β-strand	159	1	9
β-strand	171-184	14	9
β-strand	191-203	13	9

Chain E: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	0-13	14
β-strand	27-42	16	10
β-strand	47-59	13	10
α-helix	61-63	3
β-strand	73-77	5	10
α-helix	78-80	3
β-strand	86-88	3	11
β-strand	91	1	10
β-strand	96-97	2	10
β-strand	102-106	5	10
β-strand	110-113	4	10
β-strand	116-122	7	10
β-strand	134-142	9	11
β-strand	150-153	4	10
β-strand	158-159	2	11
β-strand	171-184	14	11
β-strand	191-203	13	11

Chain H: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	0-13	14
β-strand	27-42	16	17
β-strand	47-59	13	17
α-helix	61-63	3
β-strand	73-77	5	17
α-helix	78-80	3
β-strand	86-88	3	18
β-strand	91	1	17
β-strand	96-97	2	17
β-strand	102-106	5	17
β-strand	110-113	4	17
β-strand	116-122	7	17
β-strand	134-142	9	18
β-strand	150-154	5	17
β-strand	171-184	14	18
β-strand	191-203	13	18

Chain I: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	-6--4	3
α-helix	0-13	14
β-strand	27-42	16	19
β-strand	47-59	13	19
α-helix	61-63	3
β-strand	73-77	5	19
α-helix	78-80	3
β-strand	86-88	3	20
β-strand	91	1	19
β-strand	96-97	2	19
β-strand	102-106	5	19
β-strand	110-113	4	19
β-strand	116-122	7	19
β-strand	134-142	9	20
β-strand	150-153	4	19
β-strand	171-183	13	20
β-strand	192-203	12	20

Chain J: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	-6--4	3
α-helix	0-13	14
β-strand	27-42	16	21
β-strand	47-59	13	21
α-helix	61-63	3
β-strand	73-77	5	21
α-helix	78-80	3
β-strand	86-88	3	22
β-strand	91	1	21
β-strand	96-97	2	21
β-strand	102-106	5	21
β-strand	110-113	4	21
β-strand	116-122	7	21
β-strand	134-142	9	22
β-strand	150-153	4	21
β-strand	171-184	14	22
β-strand	191-203	13	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acetylcholine-binding protein	A, B, C, D, E, F, G, H, I, J	protein	218	Lymnaea stagnalis	P58154 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA

>4ZK1_1 Acetylcholine-binding protein (chains A, B, C, D, E, F, G, H, I, J)
DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVF
WQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVL
YMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFE
ILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL

Ligands and cofactors

ID	Name	Formula	Copies
4P7	(3E)-3-(1H-pyrrol-3-ylmethylidene)-3,4,5,6-tetrahydro-2,3'-bipyridine	C15 H15 N3	10
PO4	Phosphate ion	O4 P	10

Primary citation

Crystal Structure of Lymnaea stagnalis Acetylcholine-Binding Protein (LsAChBP) in Complex with 3-Pyrrolylmethylene Anabaseine. Bobango, J., Wu, J., Talley, T.T. To be published.

Other PDB entries of the same protein (UniProt P58154 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NDV 1.7 Å, X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL001888.
4ZJT 1.85 Å, X-ray crystal structure of Lymnaea stagnalis acetylcholine binding protein (LsAChBP) in…
4ZRU 1.9 Å, X-ray crystal structure of Lymnaea stagnalis acetylcholine binding protein (Ls-AChBP) in…
8P11 1.9 Å, X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL003044.
7NDP 2.0 Å, X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL001856.
7PD6 2.0 Å, Crystal structure of Lymnaea stagnalis Acetylcholine-binding protein (Ls-AChBP)…
7PE6 2.01 Å, Crystal structure of Lymnaea stagnalis Acetylcholine-binding protein (Ls-AChBP)…
5J5G 2.04 Å, X-Ray Crystal Structure of Acetylcholine Binding Protein (AChBP) in Complex with…
5J5F 2.04 Å, X-Ray Crystal Structure of Acetylcholine Binding Protein (AChBP) in Complex with…
3WTN 2.09 Å, Crystal Structure of Lymnaea stagnalis Acetylcholine Binding Protein Complexed with…
4QAC 2.1 Å, X-RAY STRUCTURE OF ACETYLCHOLINE BINDING PROTEIN (ACHBP) IN COMPLEX WITH…
7PE5 2.1 Å, Crystal structure of Lymnaea stagnalis Acetylcholine-binding protein (Ls-AChBP)…

Browse structure collections

About this viewer

MolViewer shows 4ZK1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.