Crystal structure of Lymnaea stagnalis Acetylcholine-binding protein (Ls-AChBP) Q55R/M114V double mutant complexed with Flupyrimin. Determined by X-ray diffraction at 2.01 Å resolution. Released 2 Feb 2022.
Explore 7PE6 in 3D Show helices and sheets RCSB PDB PDBe
7PE6 contains 20 α-helices and 65 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-13 | 11 | |
| α-helix | 25-26 | 2 | |
| β-strand | 27-42 | 16 | 1 |
| β-strand | 47-59 | 13 | 1 |
| α-helix | 61-63 | 3 | |
| β-strand | 73-77 | 5 | 1 |
| α-helix | 78-80 | 3 | |
| β-strand | 86-88 | 3 | 2 |
| β-strand | 91 | 1 | 1 |
| β-strand | 96-97 | 2 | 1 |
| β-strand | 102-106 | 5 | 1 |
| β-strand | 110-113 | 4 | 1 |
| β-strand | 116-122 | 7 | 1 |
| β-strand | 134-142 | 9 | 2 |
| β-strand | 150-153 | 4 | 1 |
| β-strand | 171-184 | 14 | 2 |
| β-strand | 191-203 | 13 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Acetylcholine-binding protein | AaA, BaB, CaC, DaD, EaE | protein | 210 | Lymnaea stagnalis | P58154 (AlphaFold model) |
>7PE6_1 Acetylcholine-binding protein (chains AaA, BaB, CaC, DaD, EaE) ADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQRTTWSD RTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYVPSIRQR FSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKK NSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
| ID | Name | Formula | Copies |
|---|---|---|---|
| 7OF | (~{N}~{E})-~{N}-[1-[(6-chloranylpyridin-3-yl)methyl]pyridin-2-ylidene]-2,2,2-tr… | C13 H9 Cl F3 N3 O | 5 |
Structural Biology-Guided Design, Synthesis, and Biological Evaluation of Novel Insect Nicotinic Acetylcholine Receptor Orthosteric Modulators. Montgomery, M., Rendine, S., Zimmer, C.T. et al. J Med Chem (2022) 65:2297-2312. DOI 10.1021/acs.jmedchem.1c01767 · PubMed
Other PDB entries of the same protein (UniProt P58154 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7PE6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.