5A6C: G-protein-signaling modulator 2, afadin

Concomitant binding of Afadin to LGN and F-actin directs planar spindle orientation. Determined by X-ray diffraction at 2.9 Å resolution. Released 30 Dec 2015.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 5,747
Mol. weight: 83.29 kDa
Released: 30 Dec 2015

Explore 5A6C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5A6C contains 34 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	17-29	13
α-helix	33-46	14
α-helix	51-67	17
α-helix	71-87	17
α-helix	91-107	17
α-helix	111-127	17
α-helix	131-152	22
α-helix	165-187	23
α-helix	191-208	18
α-helix	211-227	17
α-helix	231-248	18
α-helix	251-267	17
α-helix	271-287	17
α-helix	291-307	17
α-helix	311-328	18
α-helix	331-348	18
α-helix	360-362	3

Chain B: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	16-29	14
α-helix	33-46	14
α-helix	51-67	17
α-helix	71-87	17
α-helix	91-108	18
α-helix	111-127	17
α-helix	131-150	20
α-helix	165-186	22
α-helix	192-208	17
α-helix	211-228	18
α-helix	235-248	14
α-helix	251-267	17
α-helix	271-287	17
α-helix	291-307	17
α-helix	311-328	18
α-helix	331-347	17
α-helix	360-362	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
G-protein-signaling modulator 2, afadin	A, B	protein	374	HOMO SAPIENS	P55196 (AlphaFold model), P81274 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5A6C_1 G-PROTEIN-SIGNALING MODULATOR 2, AFADIN (chains A, B)
ASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKTLSAIYSQLGNAYFYLHDYAKA
LEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELNDKVGE
ARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDALQAAVDFYEENLSLVTALGDRAAQ
GRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERRAYSNLGNAYIFLGEFETA
SEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELNDRIGE
GRACWSLGNAYTALGNHDQAMHFAEKHLEISREVGDQRNASYLKTQVLSPDSLFTAKFVA
YNEEEEEEDCSLAG

Primary citation

Concomitant Binding of Afadin to Lgn and F-Actin Directs Planar Spindle Orientation. Carminati, M., Gallini, S., Pirovano, L. et al. Nat Struct Mol Biol (2016) 23:155. DOI 10.1038/NSMB.3152 · PubMed

Other PDB entries of the same protein (UniProt P55196 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QCR 2.28 Å, MLLT4/Afadin PDZ domain in complex with the C-terminal peptide from protein E of…
1T2M Solution Structure Of The Pdz Domain Of AF-6
1XZ9 Structure of AF-6 PDZ domain
2AIN Solution structure of the AF-6 PDZ domain complexed with the C-terminal peptide from the…
2EXG Making Protein-Protein Interactions Drugable: Discovery of Low-Molecular-Weight Ligands…

Browse structure collections

About this viewer

MolViewer shows 5A6C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.