5AAQ: PDB entry 5AAQ

TBK1 recruitment to cytosol-invading Salmonella induces anti- bacterial autophagy. Determined by solution NMR. Released 13 Jul 2016.

Method: Solution NMR
Organism: HOMO SAPIENS
Chains: 1
Atoms: 455
Mol. weight: 6.87 kDa
Ligands: ZN
Released: 13 Jul 2016

Explore 5AAQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5AAQ contains 4 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	396-398	3
α-helix	410-413	4
β-strand	419-422	4	1
β-strand	427-430	4	1
α-helix	431-433	3
α-helix	434-445	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium-binding and coiled-coil domain-containing protein 2	A	protein	60	HOMO SAPIENS	Q13137 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5AAQ_1 CALCIUM-BINDING AND COILED-COIL DOMAIN-CONTAINING PROTEIN 2 (chains A)
GSPSPLSIKKCPICKADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Recruitment of Tbk1 to Cytosol-Invading Salmonella Induces Wipi2-Dependent Antibacterial Autophagy. Thurston, T.L., Boyle, K.B., Allen, M. et al. EMBO J (2016) 35:1779. DOI 10.15252/EMBJ.201694491 · PubMed

Other PDB entries of the same protein (UniProt Q13137 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VVV 1.35 Å, Skich domain of NDP52
5Z7L 2.02 Å, Crystal structure of NDP52 SKICH region in complex with NAP1
4GXL 2.02 Å, The crystal structure of Galectin-8 C-CRD in complex with NDP52
4XKL 2.1 Å, Crystal structure of NDP52 ZF2 in complex with mono-ubiquitin
5Z7A 2.38 Å, Crystal structure of NDP52 SKICH region
3VVW 2.5 Å, NDP52 in complex with LC3C
4HAN 2.55 Å, Crystal structure of Galectin 8 with NDP52 peptide
7EAA 2.6 Å, crystal structure of NDP52 SKICH domain in complex with RB1CC1 coiled-coil domain
2MXP Solution structure of NDP52 ubiquitin-binding zinc finger

Browse structure collections

About this viewer

MolViewer shows 5AAQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.