5AIM: T138 central eWH domain

Crystal structure of T138 central eWH domain. Determined by X-ray diffraction at 1.4 Å resolution. Released 24 Jun 2015.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 2
Atoms: 1,790
Mol. weight: 22.53 kDa
Released: 24 Jun 2015

Explore 5AIM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5AIM contains 10 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	546-565	20
β-strand	569-571	3	1
α-helix	574-584	11
α-helix	593-604	12
β-strand	609-612	4	1
α-helix	618	1
β-strand	619-622	4	1
α-helix	628-637	10

Chain B: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	546-566	21
β-strand	569-571	3	2
α-helix	574-584	11
α-helix	589-591	3
α-helix	592-604	13
β-strand	609-613	5	2
β-strand	618-622	5	2
α-helix	628-637	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor tau 138 kda subunit	A, B	protein	100	SACCHAROMYCES CEREVISIAE	P34111 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5AIM_1 TRANSCRIPTION FACTOR TAU 138 KDA SUBUNIT (chains A, B)
GAMASARSLRSLQRQRAILKVMNTIGGVAYLREQFYESVSKYMGSTTTLDKKTVRGDVDL
MVESEKLGARTEPVSGRKIIFLPTVGEDAIQRYILKEKDS

Primary citation

Architecture of TFIIIC and its role in RNA polymerase III pre-initiation complex assembly. Male, G., von Appen, A., Glatt, S. et al. Nat Commun (2015) 6:7387-7387. DOI 10.1038/ncomms8387 · PubMed

Other PDB entries of the same protein (UniProt P34111 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GC3 2.46 Å, yeast TFIIIC TauB subcomplex bound to a tRNA gene
9GCK 3.7 Å, yeast TFIIIC TauA subcomplex bound to a tRNA gene
8FFZ 3.8 Å, TFIIIA-TFIIIC-Brf1-TBP complex bound to 5S rRNA gene

Browse structure collections

About this viewer

MolViewer shows 5AIM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.