5AIO: T131 N-terminal TPR array

Crystal structure of t131 N-terminal TPR array. Determined by X-ray diffraction at 3.15 Å resolution. Released 24 Jun 2015.

Method: X-ray diffraction
Resolution: 3.15 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 1
Atoms: 3,442
Mol. weight: 52.44 kDa
Released: 24 Jun 2015

Explore 5AIO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5AIO contains 31 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 0 β-strands

Element	Residues	Length
α-helix	133-141	9
α-helix	146-150	5
α-helix	151-157	7
α-helix	162-175	14
α-helix	178-189	12
α-helix	196-208	13
α-helix	212-225	14
α-helix	230-243	14
α-helix	246-259	14
α-helix	264-276	13
α-helix	280-314	35
α-helix	344-349	6
α-helix	352-354	3
α-helix	357-370	14
α-helix	374-387	14
α-helix	388-390	3
α-helix	396-399	4
α-helix	408-412	5
α-helix	414-418	5
α-helix	432-443	12
α-helix	448-455	8
α-helix	456-458	3
α-helix	463-466	4
α-helix	467-479	13
α-helix	483-490	8
α-helix	491-495	5
α-helix	497-499	3
α-helix	502-514	13
α-helix	518-530	13
α-helix	536-548	13
α-helix	552-563	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor tau 131 kda subunit	A	protein	448	SACCHAROMYCES CEREVISIAE	P33339 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5AIO_1 TRANSCRIPTION FACTOR TAU 131 KDA SUBUNIT (chains A)
GAMAVLDPEVAQLLSQANEAFVRNDLQVAERLFNEVIKKDARNFAAYETLGDIYQLQGRL
NDCCNSWFLAAHLNASDWEFWKIVAILSADLDHVRQAIYCFSRVISLNPMEWESIYRRSM
LYKKTGQLARALDGFQRLYMYNPYDANILRELAILYVDYDRIEDSIELYMKVFNANVERR
EAILAALENALDSSDEESAAEGEDADEKEPLEQDEDRQMFPDINWKKIDAKYKCIPFDWS
SLNILAELFLKLAVSEVDGIKTIKKCARWIQRRESQTFWDHVPDDSEFDNRRFKNSTFDS
LLAAEKEKSYNIPIDIRVRLGLLRLNTDNLVEALNHFQCLYDETFSDVADLYFEAATALT
RAEKYKEAIDFFTPLLSLEEWRTTDVFKPLARCYKEIESYETAKEFYELAIKSEPDDLDI
RVSLAEVYYRLNDPETFKHMLVDVVEMR

Primary citation

Architecture of TFIIIC and its role in RNA polymerase III pre-initiation complex assembly. Male, G., von Appen, A., Glatt, S. et al. Nat Commun (2015) 6:7387-7387. DOI 10.1038/ncomms8387 · PubMed

Other PDB entries of the same protein (UniProt P33339 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YJ6 3.1 Å, Structure of the TFIIIC subcomplex tauA
5AEM 3.4 Å, Structure of t131 N-terminal TPR array
9GCK 3.7 Å, yeast TFIIIC TauA subcomplex bound to a tRNA gene
8FFZ 3.8 Å, TFIIIA-TFIIIC-Brf1-TBP complex bound to 5S rRNA gene

Browse structure collections

About this viewer

MolViewer shows 5AIO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.