5AJ1: Smarc Domain

Solution Structure of the Smarc Domain. Determined by solution NMR. Released 5 Aug 2015.

Method: Solution NMR
Organism: HOMO SAPIENS
Chains: 1
Atoms: 907
Mol. weight: 13 kDa
Released: 5 Aug 2015

Explore 5AJ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5AJ1 contains 8 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	13-15	3
β-strand	16-18	3	1
β-strand	25-28	4	1
α-helix	29-36	8
α-helix	42-46	5
β-strand	52-54	3	1
α-helix	55-56	2
α-helix	57-62	6
α-helix	63-67	5
β-strand	89-92	4	1
α-helix	93-101	9
α-helix	105-108	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Swi/snf-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1	A	protein	115	HOMO SAPIENS	Q12824 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5AJ1_1 SWI/SNF-RELATED MATRIX-ASSOCIATED ACTIN-DEPENDENT REGULATOR OF CHROMATIN SUBFAMILY B MEMBER 1 (chains A)
GGSMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVE
ERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSIS

Primary citation

The Swi/Snf Subunit Ini1 Contains an N-Terminal Winged Helix DNA Binding Domain that is a Target for Mutations in Schwannomatosis. Allen, M.D., Freund, S.M.V., Zinzalla, G. et al. Structure (2015) 23:1344. DOI 10.1016/J.STR.2015.04.021 · PubMed

Other PDB entries of the same protein (UniProt Q12824 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GJK 2.05 Å, Crystal Structure of BAF47 and BAF155 Complex
5L7A 2.1 Å, The crystal structure of the Human SNF5/INI1 domain
6KZ7 2.28 Å, The crystal structure of BAF155 SWIRM domain and N-terminal elongated hSNF5 RPT1 domain…
6KAG 2.6 Å, Crystal structure of the SMARCB1/SMARCC2 subcomplex
6LTH 3.0 Å, Structure of human BAF Base module
7VDV 3.4 Å, The overall structure of human chromatin remodeling PBAF-nucleosome complex
9RL4 3.5 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL-6
6LTJ 3.7 Å, Structure of nucleosome-bound human BAF complex
9RN2 4.1 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 2
9RMC 4.2 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 1
7Y8R 4.4 Å, The nucleosome-bound human PBAF complex
9RN1 5.9 Å, Structure of BAF-nucleosome complex with OCT4-SOX2 at SHL+6 in ADP-bound state, BAF47…

Browse structure collections

About this viewer

MolViewer shows 5AJ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.