5L7A: Human SNF5/INI1 domain

The crystal structure of the Human SNF5/INI1 domain. Determined by X-ray diffraction at 2.1 Å resolution. Released 10 May 2017.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,247
Mol. weight: 32.54 kDa
Released: 10 May 2017

Explore 5L7A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5L7A contains 9 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	186-195	10	1
β-strand	198-207	10	1
α-helix	215-225	11
α-helix	230-245	16

Chain B: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	186-195	10	2
β-strand	198-207	10	2
α-helix	215-226	12
α-helix	230-244	15

Chain C: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	182-184	3
β-strand	186-195	10	2
β-strand	198-207	10	2
α-helix	215-226	12
α-helix	230-247	18

Chain D: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	186-195	10	1
β-strand	198-207	10	1
α-helix	215-225	11
α-helix	230-247	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1	A, B, C, D	protein	72	Homo sapiens	Q12824 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5L7A_1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (chains A, B, C, D)
GGSEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASA
IRQQIESYPTDS

Primary citation

The structure of INI1/hSNF5 RPT1 and its interactions with the c-MYC:MAX heterodimer provide insights into the interplay between MYC and the SWI/SNF chromatin remodeling complex. Sammak, S., Allen, M.D., Hamdani, N. et al. FEBS J (2018) 285:4165-4180. DOI 10.1111/febs.14660 · PubMed

Other PDB entries of the same protein (UniProt Q12824 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GJK 2.05 Å, Crystal Structure of BAF47 and BAF155 Complex
6KZ7 2.28 Å, The crystal structure of BAF155 SWIRM domain and N-terminal elongated hSNF5 RPT1 domain…
6KAG 2.6 Å, Crystal structure of the SMARCB1/SMARCC2 subcomplex
6LTH 3.0 Å, Structure of human BAF Base module
7VDV 3.4 Å, The overall structure of human chromatin remodeling PBAF-nucleosome complex
9RL4 3.5 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL-6
6LTJ 3.7 Å, Structure of nucleosome-bound human BAF complex
9RN2 4.1 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 2
9RMC 4.2 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 1
7Y8R 4.4 Å, The nucleosome-bound human PBAF complex
9RN1 5.9 Å, Structure of BAF-nucleosome complex with OCT4-SOX2 at SHL+6 in ADP-bound state, BAF47…
5AJ1 Solution Structure of the Smarc Domain

Browse structure collections

About this viewer

MolViewer shows 5L7A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.