5AN3: Sgt1-Skp1 Complex

Structure of an Sgt1-Skp1 Complex. Determined by X-ray diffraction at 2.82 Å resolution. Released 8 Feb 2017.

Method: X-ray diffraction
Resolution: 2.82 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 4
Atoms: 3,729
Mol. weight: 67.36 kDa
Released: 8 Feb 2017

Explore 5AN3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5AN3 contains 34 α-helices and 3 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	4-11	8
α-helix	12-16	5
α-helix	20-33	14
α-helix	38-52	15
α-helix	56-58	3
α-helix	61-79	19
α-helix	84-100	17
α-helix	104-116	13
α-helix	124-133	10

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	3-11	9
α-helix	12-16	5
α-helix	20-33	14
α-helix	38-52	15
α-helix	56-58	3
α-helix	61-81	21
α-helix	84-100	17
α-helix	104-116	13
α-helix	124-135	12

Chain C: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	3-11	9
α-helix	12-16	5
α-helix	20-33	14
α-helix	38-52	15
α-helix	56-58	3
α-helix	61-81	21
α-helix	84-100	17
α-helix	104-116	13
α-helix	124-132	9

Chain D: 7 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	1
β-strand	15-19	5	1
α-helix	20-23	4
α-helix	27-33	7
β-strand	76-78	3	1
α-helix	84-96	13
α-helix	118-123	6
α-helix	128-140	13
α-helix	144-152	9
α-helix	154-157	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SGT1	A, B, C	protein	150	SACCHAROMYCES CEREVISIAE	Q08446 (AlphaFold model)
Suppressor of kinetochore protein 1	D	protein	131	SACCHAROMYCES CEREVISIAE	P52286 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>5AN3_1 SGT1 (chains A, B, C)
MPVEKDLKTAYKALYDEKEPLKALHLYDEILKGSPTNLTALIFKAACLEKLYFGFSDWHS
DATMENAKELLDKALMTAEGRGDRSKIGLVNFRYFVHFFNIKDYELAQSYFKKAKNLGYV
DDTLPLWEDRLETKLNKKNKKQKDSTNKHT

Sequence of entity 2 (D), FASTA

>5AN3_2 SUPPRESSOR OF KINETOCHORE PROTEIN 1 (chains D)
MVTSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDASGDDDDEDDDEIVMPVPNVRSSVL
QKVIEWAEHHRDSNFPDEDDDDSRKSAPVDSWDREFLKVDQEMLYEIILAANYLNIKPLL
DAGCKVVAEMI

Primary citation

The crystal structure of the Sgt1-Skp1 complex: the link between Hsp90 and both SCF E3 ubiquitin ligases and kinetochores. Willhoft, O., Kerr, R., Patel, D. et al. Sci Rep (2017) 7:41626-41626. DOI 10.1038/srep41626 · PubMed

Other PDB entries of the same protein (UniProt Q08446 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Q8O 2.1 Å, Crystal structure of Hsp82-MD in complex with the CS domain of Sgt1

Browse structure collections

About this viewer

MolViewer shows 5AN3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.