5ANM: IgE Fc

Crystal structure of IgE Fc in complex with a neutralizing antibody. Determined by X-ray diffraction at 2.85 Å resolution. Released 30 Sept 2015.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: HOMO SAPIENS
Chains: 9
Atoms: 14,788
Mol. weight: 228.13 kDa
Released: 30 Sept 2015

Explore 5ANM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5ANM contains 70 α-helices and 193 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	9-11	3	2
β-strand	18-23	6	1
α-helix	29-31	3
β-strand	36-40	5	2
β-strand	47-50	4	2
β-strand	51	1	3
β-strand	55	1	3
α-helix	56-57	2
β-strand	64-68	5	1
β-strand	72-77	6	1
α-helix	82-84	3
β-strand	87-91	5	2
β-strand	94	1	4
β-strand	99	1	4
α-helix	101	1
β-strand	102	1	2
α-helix	103	1
β-strand	106-109	4	2
β-strand	116	1	5
α-helix	117-118	2
β-strand	119-123	5	6
α-helix	124-126	3
α-helix	127-131	5
β-strand	136-144	9	6
β-strand	145	1	5
β-strand	150-155	6	7
β-strand	158-159	2	7
β-strand	164-166	3	6
α-helix	167-169	3
β-strand	170-171	2	6
β-strand	177-184	8	6
α-helix	187-192	6
β-strand	196-202	7	7
β-strand	205-211	7	7

Chain B: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	8
β-strand	10-12	3	9
β-strand	18-25	8	8
α-helix	29-31	3
β-strand	34-39	6	9
β-strand	46-51	6	9
β-strand	58-60	3	9
α-helix	62-64	3
β-strand	68-73	6	8
α-helix	74-76	3
β-strand	78-83	6	8
α-helix	88-90	3
β-strand	92-98	7	9
β-strand	110-111	2	9
β-strand	115-119	5	9
β-strand	125	1	10
α-helix	126-127	2
β-strand	128-132	5	11
β-strand	143-153	11	11
β-strand	154	1	10
β-strand	159-162	4	12
α-helix	163-165	3
β-strand	167	1	12
β-strand	171-173	3	11
α-helix	174-176	3
β-strand	177-178	2	11
β-strand	184-193	10	11
α-helix	194-196	3
β-strand	203-208	6	12
α-helix	209-211	3
β-strand	213-218	6	12

Chain C: 9 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	13
β-strand	9-12	4	14
β-strand	18-23	6	13
α-helix	29-31	3
β-strand	35-40	6	14
α-helix	45-46	2
β-strand	47-50	4	14
β-strand	51	1	15
β-strand	55	1	15
β-strand	64-68	5	13
β-strand	72-77	6	13
α-helix	82-84	3
β-strand	86-92	7	14
β-strand	94	1	16
β-strand	99	1	16
α-helix	101	1
β-strand	102	1	14
α-helix	103	1
β-strand	106-110	5	14
β-strand	116	1	17
α-helix	117-118	2
β-strand	119-123	5	18
α-helix	127-131	5
β-strand	135-144	10	18
β-strand	145	1	17
β-strand	150-155	6	19
β-strand	158-160	3	19
β-strand	164-166	3	18
α-helix	167-169	3
β-strand	170-171	2	18
β-strand	177-185	9	18
α-helix	187-192	6
β-strand	196-202	7	19
β-strand	205-211	7	19

Chain D: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	20
β-strand	10-12	3	21
β-strand	18-25	8	20
α-helix	29-31	3
β-strand	34-39	6	21
β-strand	46-52	7	21
β-strand	57-60	4	21
α-helix	62-64	3
β-strand	68-73	6	20
α-helix	74-76	3
β-strand	78-83	6	20
α-helix	88-90	3
β-strand	92-98	7	21
β-strand	110-111	2	21
β-strand	115-119	5	21
β-strand	125	1	22
α-helix	126-127	2
β-strand	128-132	5	23
α-helix	133-135	3
β-strand	143-153	11	23
β-strand	154	1	22
β-strand	159-162	4	12
α-helix	163-165	3
β-strand	167	1	12
β-strand	171-173	3	23
α-helix	174-176	3
β-strand	177-178	2	23
β-strand	184-193	10	23
α-helix	194-196	3
β-strand	203-208	6	12
α-helix	209-211	3
β-strand	213-218	6	12

Chain E: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	338-340	3	24
β-strand	355-362	8	24
β-strand	371-376	6	25
β-strand	386-391	6	24
β-strand	397-404	8	24
α-helix	407-411	5
β-strand	415-421	7	25
β-strand	429-434	6	25
β-strand	441	1	26
β-strand	444-449	6	27
α-helix	450-452	3
β-strand	460-467	8	27
β-strand	470	1	26
β-strand	475-480	6	28
β-strand	483-484	2	28
α-helix	485-486	2
α-helix	487-489	3
β-strand	490-492	3	27
α-helix	493-495	3
β-strand	496	1	29
β-strand	504	1	29
β-strand	505-511	7	27
α-helix	513-518	6
β-strand	522-527	6	28
β-strand	536-537	2	28
β-strand	540-541	2	28

Chain F: 8 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	336-340	5	30
α-helix	341-344	4
α-helix	345	1
α-helix	346-350	5
β-strand	355-362	8	30
β-strand	371-376	6	31
β-strand	388-391	4	30
β-strand	397-404	8	30
α-helix	407-411	5
β-strand	415-421	7	31
β-strand	429-434	6	31
β-strand	441	1	32
β-strand	444-449	6	33
β-strand	459-469	11	33
β-strand	470	1	32
β-strand	475-480	6	34
β-strand	483-484	2	34
α-helix	485-486	2
α-helix	487-489	3
β-strand	490-492	3	33
α-helix	493-495	3
β-strand	496-497	2	33
β-strand	503-512	10	33
α-helix	513-516	4
β-strand	522-527	6	34
β-strand	536-541	6	34

Chain G: 12 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	336-340	5	35
α-helix	341-344	4
α-helix	345	1
α-helix	346-351	6
β-strand	355-362	8	35
β-strand	371-376	6	36
β-strand	386-391	6	35
β-strand	397-404	8	35
α-helix	407-411	5
β-strand	416-421	6	36
β-strand	429-433	5	36
α-helix	435-437	3
β-strand	441	1	37
α-helix	442-443	2
β-strand	444-449	6	38
α-helix	450-452	3
β-strand	459-469	11	38
β-strand	470	1	37
β-strand	475-480	6	39
β-strand	483-484	2	39
α-helix	485-486	2
α-helix	487-489	3
β-strand	490-492	3	38
α-helix	493-495	3
β-strand	496-497	2	38
α-helix	498	1
β-strand	503-512	10	38
α-helix	513-518	6
β-strand	522-527	6	39
β-strand	536-541	6	39

Chain H: 5 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	40
α-helix	7-8	2
β-strand	10-12	3	41
β-strand	18-25	8	40
β-strand	34-39	6	41
β-strand	46-51	6	41
β-strand	58-60	3	41
β-strand	68-73	6	40
β-strand	78-83	6	40
α-helix	88-90	3
β-strand	92-98	7	41
β-strand	110-111	2	41
β-strand	115-119	5	41
α-helix	122-124	3
α-helix	126-127	2
β-strand	128-130	3	42
β-strand	143-153	11	42
β-strand	159-162	4	43
β-strand	167	1	43
β-strand	171-173	3	42
α-helix	174-176	3
β-strand	177-178	2	42
β-strand	184-193	10	42
β-strand	203-208	6	43
β-strand	213-218	6	43

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin G	A, C, L	protein	217	HOMO SAPIENS
Immunoglobulin G	B, D, H	protein	229	HOMO SAPIENS
Ig epsilon chain C region	E, F, G	protein	242	HOMO SAPIENS	P01854 (AlphaFold model)

Sequence of entity 1 (A, C, L), FASTA

>5ANM_1 IMMUNOGLOBULIN G (chains A, C, L)
QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYDNFNRPSGV
PDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSPTLTSPFGTGTKLTVLGQPKAAPSV
TLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAAS
SYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Sequence of entity 2 (B, D, H), FASTA

>5ANM_2 IMMUNOGLOBULIN G (chains B, D, H)
EVQLVQSGAEVKKPGATVKISCKVYGYIFTDYNIYWVRQAPGKGLEWMGLIDPDNGETFY
AEKFQGRATMTADTSSDRAYMELSSLRFEDTAVYYCATVMGKWIKGGYDYWGRGTLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT

Sequence of entity 3 (E, F, G), FASTA

>5ANM_3 IG EPSILON CHAIN C REGION (chains E, F, G)
ADPCDSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHS
TRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEV
YAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFV
FSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPGKDYKDDDDKAAHHHHHHHH
HH

Primary citation

A Novel Ige-Neutralizing Antibody for the Treatment of Severe Uncontrolled Asthma. Cohen, E.S., Dobson, C.L., Kack, H. et al. MAbs (2015) 6:756. DOI 10.4161/MABS.28394 · PubMed

Other PDB entries of the same protein (UniProt P01854 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MOL 1.75 Å, Human IgE-Fc crystal structure
2WQR 1.9 Å, The high resolution crystal structure of IgE Fc
5MOK 2.0 Å, Crystal structure of human IgE-Fc epsilon 3-4
5MOI 2.2 Å, Crystal structure of human IgE-Fc epsilon 3-4
3H9Y 2.23 Å, Crystal structure of the IgE-Fc3-4 domains
5MOJ 2.26 Å, Crystal structure of IgE-Fc epsilon 3-4
1FP5 2.3 Å, Crystal structure analysis of the human IgE-fc CEPSILON3-CEPSILON4 fragment.
30AF 2.4 Å, Complex between IgE-Fc and anti-IgE Fab aeFab98
3H9Z 2.45 Å, Crystal structure of the IgE-Fc3-4 domains
5HYS 2.5 Å, Structure of IgE complexed with omalizumab
1O0V 2.6 Å, The crystal structure of IgE Fc reveals an asymmetrically bent conformation
5LGJ 2.6 Å, The crystal structure of IgE fc mutant - P333C

Browse structure collections

About this viewer

MolViewer shows 5ANM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.