RIP2 Kinase Catalytic Domain (1 - 310). Determined by X-ray diffraction at 2.44 Å resolution. Released 21 Oct 2015.
Explore 5AR2 in 3D Show helices and sheets RCSB PDB PDBe
5AR2 contains 31 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-9 | 3 | 1 |
| α-helix | 10-11 | 2 | |
| β-strand | 12 | 1 | 2 |
| α-helix | 15-17 | 3 | |
| β-strand | 18-23 | 6 | 2 |
| β-strand | 32-37 | 6 | 2 |
| β-strand | 43-47 | 5 | 2 |
| α-helix | 59-72 | 14 | |
| β-strand | 78 | 1 | 3 |
| α-helix | 79-80 | 2 | |
| β-strand | 81-86 | 6 | 2 |
| β-strand | 91-96 | 6 | 2 |
| β-strand | 102 | 1 | 3 |
| α-helix | 103-108 | 6 | |
| α-helix | 118-136 | 19 | |
| β-strand | 142-143 | 2 | 4 |
| α-helix | 149-151 | 3 | |
| β-strand | 152-154 | 3 | 3 |
| β-strand | 160-162 | 3 | 3 |
| β-strand | 169-170 | 2 | 4 |
| α-helix | 195-197 | 3 | |
| α-helix | 210-224 | 15 | |
| α-helix | 235-243 | 9 | |
| α-helix | 262-272 | 11 | |
| α-helix | 277-279 | 3 | |
| α-helix | 281-282 | 2 | |
| α-helix | 283-294 | 12 | |
| α-helix | 299-307 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-9 | 3 | 1 |
| α-helix | 10-11 | 2 | |
| β-strand | 12 | 1 | 5 |
| α-helix | 15-17 | 3 | |
| β-strand | 18-25 | 8 | 5 |
| β-strand | 31-37 | 7 | 5 |
| β-strand | 43-48 | 6 | 5 |
| α-helix | 59-72 | 14 | |
| β-strand | 78 | 1 | 6 |
| α-helix | 79-80 | 2 | |
| β-strand | 81-86 | 6 | 5 |
| β-strand | 91-96 | 6 | 5 |
| β-strand | 102 | 1 | 6 |
| α-helix | 103-108 | 6 | |
| α-helix | 118-136 | 19 | |
| β-strand | 142-143 | 2 | 7 |
| α-helix | 149-151 | 3 | |
| β-strand | 152-154 | 3 | 6 |
| β-strand | 160-162 | 3 | 6 |
| β-strand | 169-170 | 2 | 7 |
| α-helix | 185-187 | 3 | |
| α-helix | 195-197 | 3 | |
| α-helix | 210-224 | 15 | |
| α-helix | 235-243 | 9 | |
| α-helix | 262-272 | 11 | |
| α-helix | 277-279 | 3 | |
| α-helix | 281-282 | 2 | |
| α-helix | 283-294 | 12 | |
| α-helix | 299-309 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Receptor-interacting serine/threonine-protein kinase 2 | A, B | protein | 326 | HOMO SAPIENS | O43353 (AlphaFold model) |
>5AR2_1 RECEPTOR-INTERACTING SERINE/THREONINE-PROTEIN KINASE 2 (chains A, B) MDYKDDDDKENLYFQGMNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQV AVKHLHIHTPLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLN ELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIAD FGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLS RKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFL KCLIELEPVLRTFEEITFLEAVIQLK
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
Crystal Structures of Human Rip2 Kinase Catalytic Domain Complexed with ATP-Competitive Inhibitors: Foundations for Understanding Inhibitor Selectivity. Charnley, A.K., Convery, M.A., Lakdawala Shah, A. et al. Bioorg Med Chem (2015) 23:7000. DOI 10.1016/J.BMC.2015.09.038 · PubMed
Other PDB entries of the same protein (UniProt O43353 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5AR2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.