Structure of RIP2K(L294F) with bound AMPPCP. Determined by X-ray diffraction at 2.0 Å resolution. Released 7 Jun 2017.
Explore 5NG0 in 3D Show helices and sheets RCSB PDB PDBe
5NG0 contains 34 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-9 | 3 | 1 |
| α-helix | 10-11 | 2 | |
| β-strand | 12 | 1 | 2 |
| α-helix | 15-17 | 3 | |
| β-strand | 18-26 | 9 | 2 |
| β-strand | 31-37 | 7 | 2 |
| β-strand | 43-48 | 6 | 2 |
| α-helix | 57-72 | 16 | |
| β-strand | 78 | 1 | 3 |
| α-helix | 79-80 | 2 | |
| β-strand | 81-87 | 7 | 2 |
| β-strand | 90-96 | 7 | 2 |
| β-strand | 102 | 1 | 3 |
| α-helix | 103-108 | 6 | |
| α-helix | 118-136 | 19 | |
| α-helix | 141 | 1 | |
| β-strand | 142-143 | 2 | 4 |
| α-helix | 149-151 | 3 | |
| β-strand | 152-154 | 3 | 3 |
| β-strand | 160-162 | 3 | 3 |
| β-strand | 169-170 | 2 | 4 |
| α-helix | 195-197 | 3 | |
| α-helix | 210-224 | 15 | |
| α-helix | 235-243 | 9 | |
| α-helix | 262-272 | 11 | |
| α-helix | 277-279 | 3 | |
| α-helix | 281-282 | 2 | |
| α-helix | 283-295 | 13 | |
| α-helix | 298-299 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-9 | 3 | 1 |
| α-helix | 10-11 | 2 | |
| β-strand | 12 | 1 | 5 |
| α-helix | 15-17 | 3 | |
| β-strand | 18-26 | 9 | 5 |
| β-strand | 31-37 | 7 | 5 |
| β-strand | 43-48 | 6 | 5 |
| α-helix | 57-72 | 16 | |
| β-strand | 78 | 1 | 6 |
| α-helix | 79-80 | 2 | |
| β-strand | 81-87 | 7 | 5 |
| β-strand | 90-96 | 7 | 5 |
| β-strand | 102 | 1 | 6 |
| α-helix | 103-108 | 6 | |
| α-helix | 118-136 | 19 | |
| α-helix | 141 | 1 | |
| β-strand | 142-143 | 2 | 7 |
| α-helix | 149-151 | 3 | |
| β-strand | 152-154 | 3 | 6 |
| β-strand | 160-162 | 3 | 6 |
| β-strand | 169-170 | 2 | 7 |
| α-helix | 184-186 | 3 | |
| α-helix | 190-192 | 3 | |
| α-helix | 195-197 | 3 | |
| α-helix | 206-209 | 4 | |
| α-helix | 210-224 | 15 | |
| α-helix | 235-243 | 9 | |
| α-helix | 262-272 | 11 | |
| α-helix | 277-279 | 3 | |
| α-helix | 281-282 | 2 | |
| α-helix | 283-295 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Receptor-interacting serine/threonine-protein kinase 2 | A, B | protein | 304 | Homo sapiens | O43353 (AlphaFold model) |
>5NG0_1 Receptor-interacting serine/threonine-protein kinase 2 (chains A, B) GAMAMNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLL DSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDV AWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLS QSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPL QIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVFRT FEEI
| ID | Name | Formula | Copies |
|---|---|---|---|
| CO | Cobalt (II) ion | Co | 1 |
| MG | Magnesium ion | Mg | 2 |
| ACP | Phosphomethylphosphonic acid adenylate ester | C11 H18 N5 O12 P3 | 2 |
Structures of the inactive and active states of RIP2 kinase inform on the mechanism of activation. Pellegrini, E., Signor, L., Singh, S. et al. PLoS One (2017) 12:e0177161-e0177161. DOI 10.1371/journal.pone.0177161 · PubMed
Other PDB entries of the same protein (UniProt O43353 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5NG0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.