5B0M: MoeN5-Sso7d fusion protein

Structure of MoeN5-Sso7d fusion protein in complex with beta-dodecyl maltoside. Determined by X-ray diffraction at 3.05 Å resolution. Released 23 Mar 2016.

Method

X-ray diffraction

Resolution

3.05 Å

Organisms

Streptomyces ghanaensis, Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

Chains

8

Atoms

19,074

Mol. weight

304.74 kDa

Ligands

LMT

Released

23 Mar 2016

Explore 5B0M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5B0M contains 133 α-helices and 20 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 0 β-strands

Molecules and chains

>5B0M_1 MoeN5,DNA-binding protein 7d (chains A, B, C, D, E, F, G, H)
MAHHHHHHVDDDDKMLAAEAANRDHVTRCVAQTGGSPDLVAHTAALRLYLRVPHFLTEWT
TDPDRRAAVSRALALDIVSMKLLDDLMDDDTGLDRVELACVCLRLHLRALHELESLARDP
KAVTDILEQDAVHLCGGQIRTKRSRATNLREWRAHASTYGSTFLGRYGALAAACGGEGQP
ADSVREFAEAFAMTITMADDLTDYDRNGERDGNLAHLMRTGAVAGQDVVDLLEELRGRAL
AAVAAPPGAPGLVPVVHLYTDDVLVRLLPRHLGEAGAGAMATVKFKYKGEEKEVDISKIK
KVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK

Ligands and cofactors

Primary citation

Moenomycin Biosynthesis: Structure and Mechanism of Action of the Prenyltransferase MoeN5. Zhang, L., Chen, C.C., Ko, T.P. et al. Angew Chem Int Ed Engl (2016) 55:4716-4720. DOI 10.1002/anie.201511388 · PubMed

Related structures

Other PDB entries of the same protein (UniProt A0A010 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 5B02 2.21 Å, Structure of the prenyltransferase MoeN5 with a fusion protein tag of Sso7d
• 6J8V 2.23 Å, Structure of MOEN5-SSO7D fusion protein in complex with ligand 2
• 5B0I 2.26 Å, Structure of MoeN5-Sso7d fusion protein in complex with beta-octyl glucoside
• 5GWW 2.3 Å, Structure of MoeN5-Sso7d fusion protein in complex with a permethylated substrate analogue
• 6J8W 2.35 Å, Structure of MOEN5-SSO7D fusion protein in complex with lig 1
• 5GWV 2.4 Å, Structure of MoeN5-Sso7d fusion protein in complex with a substrate analogue
• 5B0J 2.5 Å, Structure of MoeN5-Sso7d fusion protein in complex with beta-undecyl maltoside
• 5B03 2.6 Å, Structure of MoeN5-Sso7d fusion protein in complex with geranyl pyrophosphate
• 5B0K 2.75 Å, Structure of MoeN5-Sso7d fusion protein in complex with beta-decyl maltoside
• 5B0L 2.8 Å, Structure of MoeN5-Sso7d fusion protein in complex with beta-nonyl glucoside
• 5B00 2.95 Å, Structure of the prenyltransferase MoeN5 in complex with geranyl pyrophosphate
• 5B01 3.45 Å, Structure of a prenyltransferase in its unbound form

Browse structure collections

About this viewer

MolViewer shows 5B0M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.