5B5W: MOB1-LATS1 NTR domain complex

Crystal structure of MOB1-LATS1 NTR domain complex. Determined by X-ray diffraction at 2.96 Å resolution. Released 6 Jul 2016.

Method: X-ray diffraction
Resolution: 2.96 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 1,966
Mol. weight: 32.04 kDa
Ligands: ZN
Released: 6 Jul 2016

Explore 5B5W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5B5W contains 11 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	47-48	2
α-helix	53-75	23
β-strand	88-89	2	1
β-strand	93-94	2	1
α-helix	111-127	17
α-helix	138-141	4
α-helix	144-165	22
α-helix	167-171	5
α-helix	176-193	18
α-helix	198-204	7
α-helix	205-211	7

Chain U: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	636-668	33
α-helix	674-696	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MOB kinase activator 1B	A	protein	186	Mus musculus	Q8BPB0 (AlphaFold model)
Serine/threonine-protein kinase LATS1	U	protein	85	Homo sapiens	O95835 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5B5W_1 MOB kinase activator 1B (chains A)
GPEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAG
PKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKT
ILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEK
LTSKDR

Sequence of entity 2 (U), FASTA

>5B5W_2 Serine/threonine-protein kinase LATS1 (chains U)
GPKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHRKKQLENEMMRVGLSQDAQD
QMRKMLCQKESNYIRLKRAKMDKSM

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Structural basis for autoinhibition and its relief of MOB1 in the Hippo pathway. Kim, S.Y., Tachioka, Y., Mori, T. et al. Sci Rep (2016) 6:28488-28488. DOI 10.1038/srep28488 · PubMed

Other PDB entries of the same protein (UniProt Q8BPB0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5B5V 2.19 Å, Structure of full-length MOB1b
5B6B 3.54 Å, Complex of LATS1 and phosphomimetic MOB1b

Browse structure collections

About this viewer

MolViewer shows 5B5W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.