5BPV: Polymerase cofactor VP35

Crystal Structure of Zaire ebolavirus VP35 RNA binding domain mutant I278A. Determined by X-ray diffraction at 1.95 Å resolution. Released 29 Jun 2016.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Zaire ebolavirus
Chains: 2
Atoms: 2,209
Mol. weight: 27.31 kDa
Released: 29 Jun 2016

Explore 5BPV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5BPV contains 21 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	218-220	3
α-helix	221-231	11
α-helix	238-252	15
α-helix	256-269	14
α-helix	273-283	11
α-helix	285-287	3
α-helix	290-293	4
β-strand	294-296	3	1
α-helix	300-302	3
α-helix	305-310	6
β-strand	311-312	2	1
α-helix	313-315	3
α-helix	320-322	3
β-strand	324-329	6	1
β-strand	335-339	5	1

Chain B: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	221-231	11
α-helix	238-252	15
α-helix	256-269	14
α-helix	273-283	11
α-helix	285-287	3
α-helix	290-293	4
β-strand	294-296	3	2
α-helix	300-302	3
α-helix	305-310	6
β-strand	311-312	2	2
α-helix	313-315	3
α-helix	320-322	3
β-strand	324-329	6	2
β-strand	335-339	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polymerase cofactor VP35	A, B	protein	124	Zaire ebolavirus	Q05127 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5BPV_1 Polymerase cofactor VP35 (chains A, B)
PDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCA
LAQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTL
GLKI

Primary citation

Crystal Structure of Zaire ebolavirus VP35 RNA binding domain mutant I278A. Fadda, V., Cannas, V., Zinzula, L. et al. To be published.

Other PDB entries of the same protein (UniProt Q05127 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FKE 1.4 Å, Structure of the Ebola VP35 Interferon Inhibitory Domain
4IBG 1.41 Å, Ebola virus VP35 bound to small molecule
4IBI 1.47 Å, Ebola virus VP35 bound to small molecule
4IBJ 1.54 Å, Ebola virus VP35 bound to small molecule
3L29 1.7 Å, Crystal Structure of Zaire Ebola VP35 interferon inhibitory domain K319A/R322A mutant
4IBC 1.75 Å, Ebola virus VP35 bound to small molecule
4IBB 1.75 Å, Ebola virus VP35 bound to small molecule
4IBD 1.84 Å, Ebola virus VP35 bound to small molecule
4IBK 1.85 Å, Ebola virus VP35 bound to small molecule
4IJE 1.9 Å, Crystal structure of the Zaire ebolavirus VP35 interferon inhibitory domain…
3L27 1.95 Å, Crystal structure of Zaire Ebola VP35 interferon inhibitory domain R312A mutant
4IBE 1.95 Å, Ebola virus VP35 bound to small molecule

Browse structure collections

About this viewer

MolViewer shows 5BPV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.