5BXU: Human Tankyrase-2

Human Tankyrase-2 in Complex with Macrocyclised Extended Peptide cp4n4m5. Determined by X-ray diffraction at 1.35 Å resolution. Released 29 Jun 2016.

Method: X-ray diffraction
Resolution: 1.35 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,576
Mol. weight: 18.89 kDa
Ligands: 4XQ
Released: 29 Jun 2016

Explore 5BXU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5BXU contains 11 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	491-502	12
α-helix	505-511	7
α-helix	529-535	7
α-helix	539-546	8
α-helix	562-568	7
α-helix	572-580	9
α-helix	595-601	7
α-helix	605-613	9
α-helix	629-631	3
α-helix	637-643	7

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tankyrase-2	A	protein	164	Homo sapiens	Q9H2K2 (AlphaFold model)
cp4n4m5	B	protein	9	Homo sapiens

Sequence of entity 1 (A), FASTA

>5BXU_1 Tankyrase-2 (chains A)
GSGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYL
LQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKY
EICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAAL

Sequence of entity 2 (B), FASTA

>5BXU_2 cp4n4m5 (chains B)
XREAGDGAE

Ligands and cofactors

ID	Name	Formula	Copies
4XQ	4,4'-pentane-1,5-diylbis(1-propyl-1H-1,2,3-triazole)	C15 H26 N6	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Macrocyclized Extended Peptides: Inhibiting the Substrate-Recognition Domain of Tankyrase. Xu, W., Lau, Y.H., Fischer, G. et al. J Am Chem Soc (2017) 139:2245-2256. DOI 10.1021/jacs.6b10234 · PubMed

Other PDB entries of the same protein (UniProt Q9H2K2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BXO 1.33 Å, Human Tankyrase-2 in Complex with Macrocyclised Extended Peptide cp4n2m3
5NWG 1.4 Å, Crystal structure of TNKS2 in complex with 7-chloro-2-{4-[(2-hydroxyethyl)(methyl)amino]p…
5NWD 1.45 Å, Crystal structure of TNKS2 in complex with 2-[4-(diethylamino)phenyl]-3,4-dihydroquinazol…
4PNL 1.5 Å, Crystal structure of TNKS-2 in complex with DR2313.
5NVE 1.5 Å, Crystal structure of TNKS2 in complex with 2-(4-ethoxyphenyl)-3,4-dihydroquinazolin-4-one
5NWC 1.5 Å, Crystal structure of TNKS2 in complex with 2-(2-aminophenyl)-3,4-dihydroquinazolin-4-one
7CE4 1.5 Å, Tankyrase2 catalytic domain in complex with K-476
5JRT 1.53 Å, Crystal structure of the human Tankyrase 2 (TNKS2) SAM domain (DH902/924RE)
3TWR 1.55 Å, Crystal structure of ARC4 from human Tankyrase 2 in complex with peptide from human 3BP2
5C5R 1.55 Å, Crystal structure of human tankyrase-2 in complex with a pyranopyridone inhibitor
5NVF 1.55 Å, Crystal structure of TNKS2 in complex with 2-[4-(pyridin-2-yl)phenyl]-3,4-dihydroquinazol…
4TJU 1.57 Å, Crystal Structure of human Tankyrase 2 in complex with 3,4-CPQ-5-C.

Browse structure collections

About this viewer

MolViewer shows 5BXU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.