Crystal structure of TNKS2 in complex with 7-chloro-2-{4-[(2-hydroxyethyl)(methyl)amino]phenyl}-3,4-dihydroquinazolin-4-one. Determined by X-ray diffraction at 1.4 Å resolution. Released 14 Mar 2018.
Explore 5NWG in 3D Show helices and sheets RCSB PDB PDBe
5NWG contains 21 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 954-957 | 4 | 1 |
| α-helix | 958-959 | 2 | |
| α-helix | 963-974 | 12 | |
| β-strand | 992-1001 | 10 | 1 |
| α-helix | 1003-1018 | 16 | |
| β-strand | 1026-1031 | 6 | 1 |
| α-helix | 1036-1042 | 7 | |
| α-helix | 1046-1048 | 3 | |
| β-strand | 1050 | 1 | 2 |
| β-strand | 1058 | 1 | 2 |
| β-strand | 1059-1062 | 4 | 1 |
| α-helix | 1065-1069 | 5 | |
| α-helix | 1075-1077 | 3 | |
| β-strand | 1094-1102 | 9 | 1 |
| β-strand | 1106-1109 | 4 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 954-957 | 4 | 3 |
| α-helix | 958-959 | 2 | |
| α-helix | 963-974 | 12 | |
| β-strand | 992-1001 | 10 | 3 |
| α-helix | 1003-1019 | 17 | |
| β-strand | 1026-1031 | 6 | 3 |
| α-helix | 1036-1042 | 7 | |
| α-helix | 1046-1048 | 3 | |
| β-strand | 1050 | 1 | 4 |
| β-strand | 1058 | 1 | 4 |
| β-strand | 1059-1062 | 4 | 3 |
| α-helix | 1065-1069 | 5 | |
| α-helix | 1075-1077 | 3 | |
| β-strand | 1094-1102 | 9 | 3 |
| β-strand | 1106-1111 | 6 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1117-1119 | 3 | |
| β-strand | 1124-1127 | 4 | 1 |
| α-helix | 1135-1137 | 3 | |
| β-strand | 1138-1141 | 4 | 1 |
| α-helix | 1144-1146 | 3 | |
| β-strand | 1147-1157 | 11 | 1 |
| α-helix | 1158-1160 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1117-1119 | 3 | |
| β-strand | 1124-1129 | 6 | 3 |
| β-strand | 1138-1141 | 4 | 3 |
| α-helix | 1144-1146 | 3 | |
| β-strand | 1147-1157 | 11 | 3 |
| α-helix | 1158-1160 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tankyrase-2 | A, B | protein | 191 | Homo sapiens | Q9H2K2 (AlphaFold model) |
| Tankyrase-2 | H, I | protein | 49 | Homo sapiens | Q9H2K2 (AlphaFold model) |
>5NWG_1 Tankyrase-2 (chains A, B) MHHHHHHSSGVDLGTENLYFQSMLNTSGSGTILIDLSPDDKEFQSVEEEMQSTVREHRDG GHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHK GFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVT LGKSFLQFSAM
>5NWG_2 Tankyrase-2 (chains H, I) KMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPEG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
| 9CB | 7-chloranyl-2-[4-[2-hydroxyethyl(methyl)amino]phenyl]-3~{H}-quinazolin-4-one | C17 H16 Cl N3 O2 | 2 |
Water and common crystallization additives (SO4, GOL) are not listed.
2-Phenylquinazolinones as dual-activity tankyrase-kinase inhibitors. Nkizinkiko, Y., Desantis, J., Koivunen, J. et al. Sci Rep (2018) 8:1680-1680. DOI 10.1038/s41598-018-19872-3 · PubMed
Other PDB entries of the same protein (UniProt Q9H2K2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5NWG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.