5C0M: SGF29 tandem tudor domain

Crystal structure of SGF29 tandem tudor domain in complex with a Carba containing peptide. Determined by X-ray diffraction at 1.6 Å resolution. Released 1 Jul 2015.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,353
Mol. weight: 43.07 kDa
Released: 1 Jul 2015

Explore 5C0M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5C0M contains 29 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	115-129	15
α-helix	131	1
β-strand	132	1	1
α-helix	133	1
α-helix	141-142	2
β-strand	145	1	2
α-helix	148-151	4
α-helix	156-157	2
β-strand	161-167	7	3
β-strand	173-184	12	3
β-strand	189-194	6	3
α-helix	201-202	2
β-strand	203-206	4	3
α-helix	207-209	3
β-strand	210-212	3	3
α-helix	213-214	2
β-strand	216	1	2
β-strand	217	1	1
α-helix	224-226	3
α-helix	228-229	2
β-strand	233-237	5	3
α-helix	238	1
β-strand	243-251	9	3
α-helix	258-259	2
β-strand	260-264	5	3
β-strand	265	1	4
β-strand	273	1	4
α-helix	274-276	3
β-strand	277-279	3	3
α-helix	281-283	3
β-strand	284-286	3	3

Chain B: 14 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	117-129	13
α-helix	131	1
β-strand	132	1	5
α-helix	133	1
α-helix	141-142	2
β-strand	145	1	6
α-helix	148-151	4
α-helix	156-157	2
β-strand	161-167	7	7
α-helix	168	1
β-strand	173-184	12	7
β-strand	189-194	6	7
β-strand	202-206	5	7
α-helix	207-209	3
β-strand	210-212	3	7
α-helix	213-214	2
β-strand	216	1	6
β-strand	217	1	5
α-helix	224-226	3
β-strand	233-237	5	7
α-helix	238	1
β-strand	243-251	9	7
α-helix	258-259	2
β-strand	260-264	5	7
β-strand	265	1	8
β-strand	273	1	8
α-helix	274-276	3
β-strand	277-279	3	7
α-helix	281-283	3
β-strand	284-286	3	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SAGA-associated factor 29 homolog	A, B	protein	180	Homo sapiens	Q96ES7 (AlphaFold model)
Carba-containing peptide	C, D	protein	10	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>5C0M_1 SAGA-associated factor 29 homolog (chains A, B)
GRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDE
QWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQL
VLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVACKEPKKK

Sequence of entity 2 (C, D), FASTA

>5C0M_2 Carba-containing peptide (chains C, D)
ARTXQTARKS

Primary citation

Chemical basis for the recognition of trimethyllysine by epigenetic reader proteins. Kamps, J.J., Huang, J., Poater, J. et al. Nat Commun (2015) 6:8911-8911. DOI 10.1038/ncomms9911 · PubMed

Other PDB entries of the same protein (UniProt Q96ES7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3MEA 1.26 Å, Crystal structure of the SGF29 in complex with H3K4me3
3MEU 1.28 Å, Crystal structure of SGF29 in complex with H3R2me2sK4me3
3ME9 1.37 Å, Crystal structure of SGF29 in complex with H3K4me3 peptide
3LX7 1.78 Å, Crystal structure of a Novel Tudor domain-containing protein SGF29
3MEV 1.83 Å, Crystal structure of SGF29 in complex with R2AK4me3
3MEW 1.92 Å, Crystal structure of Novel Tudor domain-containing protein SGF29
3MET 2.0 Å, Crystal structure of SGF29 in complex with H3K4me2

Browse structure collections

About this viewer

MolViewer shows 5C0M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.