5C50: Complex of human Atg101-Atg13 HORMA domain

Crystal structure of the complex of human Atg101-Atg13 HORMA domain. Determined by X-ray diffraction at 1.63 Å resolution. Released 14 Oct 2015.

Method: X-ray diffraction
Resolution: 1.63 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,315
Mol. weight: 45.06 kDa
Ligands: BEN
Released: 14 Oct 2015

Explore 5C50 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5C50 contains 15 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4-13	10	1
α-helix	14-16	3
α-helix	17-31	15
β-strand	33-34	2	2
α-helix	35-36	2
β-strand	37-39	3	3
β-strand	45-47	3	3
β-strand	49	1	4
β-strand	50	1	5
β-strand	52-56	5	6
β-strand	63-67	5	6
α-helix	70-89	20
β-strand	95-105	11	1
α-helix	106-107	2
β-strand	116-129	14	1
α-helix	134-161	28
α-helix	166-170	5
α-helix	171-176	6
β-strand	178	1	7
β-strand	186-187	2	2
β-strand	188	1	7
α-helix	189	1
β-strand	190-196	7	1

Chain B: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	12-30	19
β-strand	38	1	6
β-strand	42	1	4
α-helix	45-46	2
β-strand	53	1	5
α-helix	56-58	3
α-helix	59-69	11
β-strand	75	1	8
β-strand	78	1	8
β-strand	79-88	10	9
β-strand	93-103	11	9
α-helix	114-131	18
α-helix	136-142	7
β-strand	148-157	10	9
β-strand	169-178	10	9
β-strand	181-189	9	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Autophagy-related protein 101	A	protein	198	Homo sapiens	Q9BSB4 (AlphaFold model)
Autophagy-related protein 13	B	protein	194	Homo sapiens	O75143 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5C50_1 Autophagy-related protein 101 (chains A)
MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFI
DFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWE
VWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDT
GLRDVQPYLYKISFQITD

Sequence of entity 2 (B), FASTA

>5C50_2 Autophagy-related protein 13 (chains B)
GAMGSDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAK
KALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLK
SLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLS
CAYRINLAFMSTRQ

Ligands and cofactors

ID	Name	Formula	Copies
BEN	Benzamidine	C7 H8 N2	5

Primary citation

Structure of the Human Atg13-Atg101 HORMA Heterodimer: an Interaction Hub within the ULK1 Complex. Qi, S., Kim, D.J., Stjepanovic, G. et al. Structure (2015) 23:1848-1857. DOI 10.1016/j.str.2015.07.011 · PubMed

Other PDB entries of the same protein (UniProt Q9BSB4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4WZG 1.9 Å, Structure of human ATG101
5XUY 2.2 Å, Crystal structure of ATG101-ATG13HORMA
8DO8 2.41 Å, Crystal structure ATG9 HDIR in complex with the ATG13:ATG101 HORMA dimer
5XV6 2.46 Å, Crystal structure of ATG101-ATG13HORMA
5XV1 2.51 Å, Crystal structure of ATG101-ATG13HORMA
5XV3 2.57 Å, Crystal structure of ATG101-ATG13HORMA
5XV4 2.95 Å, Crystal structure of ATG101-ATG13HORMA

Browse structure collections

About this viewer

MolViewer shows 5C50 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.