Crystal structure of ATG101-ATG13HORMA. Determined by X-ray diffraction at 2.46 Å resolution. Released 4 Jul 2018.
Explore 5XV6 in 3D Show helices and sheets RCSB PDB PDBe
5XV6 contains 19 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-31 | 25 | |
| β-strand | 38 | 1 | 1 |
| β-strand | 42 | 1 | 2 |
| α-helix | 50-52 | 3 | |
| β-strand | 53 | 1 | 3 |
| α-helix | 56-58 | 3 | |
| α-helix | 59-69 | 11 | |
| β-strand | 79-88 | 10 | 4 |
| β-strand | 93-104 | 12 | 4 |
| α-helix | 113-117 | 5 | |
| α-helix | 118-133 | 16 | |
| α-helix | 136-142 | 7 | |
| β-strand | 148-157 | 10 | 4 |
| α-helix | 162-164 | 3 | |
| β-strand | 169-178 | 10 | 4 |
| β-strand | 181-189 | 9 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-3 | 2 | |
| β-strand | 4-13 | 10 | 5 |
| α-helix | 14-16 | 3 | |
| α-helix | 17-31 | 15 | |
| β-strand | 33-34 | 2 | 6 |
| α-helix | 35-36 | 2 | |
| β-strand | 37-39 | 3 | 7 |
| β-strand | 45-47 | 3 | 7 |
| β-strand | 49 | 1 | 2 |
| β-strand | 50 | 1 | 3 |
| β-strand | 52-56 | 5 | 1 |
| β-strand | 63-67 | 5 | 1 |
| α-helix | 70-88 | 19 | |
| β-strand | 95-106 | 12 | 5 |
| α-helix | 113-114 | 2 | |
| β-strand | 115-129 | 15 | 5 |
| α-helix | 135-161 | 27 | |
| α-helix | 166-169 | 4 | |
| α-helix | 174-176 | 3 | |
| β-strand | 178 | 1 | 8 |
| β-strand | 186-187 | 2 | 6 |
| β-strand | 188 | 1 | 8 |
| β-strand | 190-197 | 8 | 5 |
| α-helix | 198-199 | 2 | |
| α-helix | 206-213 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Autophagy-related protein 13 | A | protein | 190 | Homo sapiens | O75143 (AlphaFold model) |
| Autophagy-related protein 101 | B | protein | 218 | Homo sapiens | Q9BSB4 (AlphaFold model) |
>5XV6_1 Autophagy-related protein 13 (chains A) METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPE VTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNR LSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPV GTITLSCAYR
>5XV6_2 Autophagy-related protein 101 (chains B) MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYAAAGTYSIGTVGTQDVDCDFI DFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWE VWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDT GLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL
The C-terminal region of ATG101 bridges ULK1 and PtdIns3K complex in autophagy initiation. Kim, B.-W., Jin, Y., Kim, J. et al. Autophagy (2018) 14:2104-2116. DOI 10.1080/15548627.2018.1504716 · PubMed
Other PDB entries of the same protein (UniProt O75143 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5XV6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.