5CHT: USP18

Crystal structure of USP18. Determined by X-ray diffraction at 2.8 Å resolution. Released 29 Jun 2016.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Mus musculus
Chains: 2
Atoms: 4,941
Mol. weight: 75.32 kDa
Ligands: ZN
Released: 29 Jun 2016

Explore 5CHT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CHT contains 28 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	53-54	2	1
α-helix	61-71	11
α-helix	74-81	8
α-helix	84-86	3
α-helix	89-94	6
α-helix	96-109	14
β-strand	114-115	2	1
α-helix	118-125	8
α-helix	131-135	5
α-helix	137-151	15
α-helix	155-165	11
α-helix	166	1
β-strand	167-175	9	2
β-strand	183-188	6	2
β-strand	190-193	4	3
β-strand	196	1	4
β-strand	202	1	4
β-strand	205	1	5
α-helix	206-213	8
β-strand	217-219	3	2
α-helix	224	1
β-strand	225	1	6
α-helix	226	1
β-strand	232	1	6
β-strand	235-243	9	2
β-strand	247-252	6	3
β-strand	255-256	2	7
β-strand	263-264	2	7
β-strand	270	1	5
β-strand	274-275	2	3
β-strand	298-309	12	3
β-strand	312-320	9	3
β-strand	327-331	5	3
β-strand	334-338	5	3
α-helix	340-343	4
α-helix	344-346	3
β-strand	357-365	9	3

Chain B: 13 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	53-54	2	8
α-helix	61-71	11
α-helix	74-81	8
α-helix	83-86	4
α-helix	89-94	6
α-helix	96-109	14
β-strand	114-115	2	8
α-helix	118-125	8
α-helix	137-151	15
α-helix	155-165	11
α-helix	166	1
β-strand	167-175	9	9
β-strand	181-188	8	9
β-strand	190-193	4	10
β-strand	196	1	11
β-strand	202	1	11
β-strand	205	1	12
α-helix	206-213	8
β-strand	217-219	3	9
α-helix	224-226	3
β-strand	235-243	9	9
β-strand	247-252	6	10
β-strand	255	1	13
β-strand	264	1	13
β-strand	270	1	12
β-strand	274-276	3	10
β-strand	297-308	12	10
β-strand	313-320	8	10
β-strand	327-331	5	10
β-strand	334-338	5	10
α-helix	340-343	4
α-helix	344-347	4
β-strand	357-365	9	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubl carboxyl-terminal hydrolase 18	A, B	protein	326	Mus musculus	Q9WTV6 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5CHT_1 Ubl carboxyl-terminal hydrolase 18 (chains A, B)
GPGDSPHGLVGLHNIGQTCCLNSLLQVFMMNMDFRMILKRITVPRSAEERKRSVPFQLLL
LLEKMQDSRQKAVLPTELVQCLQKYNVPLFVQHDAAQLYLTIWNLTKDQITDTDLTERLQ
GLFTIWTQESLICVGCTAESSRRSKLLTLSLPLFDKDAKPLKTLEDALRCFVQPKELASS
DMCCESCGEKTPWKQVLKLTHLPQTLTIHLMRFSARNSRTEKICHSVNFPQSLDFSQVLP
TEEDLGDTKEQSEIHYELFAVIAHVGMADFGHYCAYIRNPVDGKWFCFNDSHVCWVTWKD
VQCTYGNHRYRWRETAYLLVYTKTGS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Structural basis of the specificity of USP18 toward ISG15. Basters, A., Geurink, P.P., Rocker, A. et al. Nat Struct Mol Biol (2017) 24:270-278. DOI 10.1038/nsmb.3371 · PubMed

Other PDB entries of the same protein (UniProt Q9WTV6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CHV 3.0 Å, Crystal structure of USP18-ISG15 complex

Browse structure collections

About this viewer

MolViewer shows 5CHT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.