5CMN: FLRT3 LRR domain

FLRT3 LRR domain in complex with LPHN3 Olfactomedin domain. Determined by X-ray diffraction at 3.6 Å resolution. Released 12 Aug 2015.

Method: X-ray diffraction
Resolution: 3.6 Å
Organism: Homo sapiens
Chains: 8
Atoms: 18,420
Mol. weight: 272.93 kDa
Ligands: CA, NAG
Released: 12 Aug 2015

Explore 5CMN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CMN contains 46 α-helices and 198 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	36-38	3	1
β-strand	41-43	3	1
β-strand	62-64	3	1
α-helix	72-74	3
α-helix	78-81	4
β-strand	87-89	3	1
β-strand	108-110	3	1
β-strand	119	1	2
α-helix	121-125	5
β-strand	132-134	3	1
β-strand	141	1	3
β-strand	145	1	2
α-helix	146	1
α-helix	149-151	3
β-strand	158-160	3	1
β-strand	165	1	3
β-strand	179-181	3	1
α-helix	192-195	4
β-strand	203-205	3	1
α-helix	213-215	3
β-strand	229-231	3	1
β-strand	239	1	4
β-strand	251-253	3	1
β-strand	261	1	4
β-strand	275-277	3	1
β-strand	299-301	3	1
β-strand	308	1	5
α-helix	311-313	3
α-helix	314-321	8
β-strand	328-330	3	1
β-strand	333	1	6
β-strand	336	1	5
α-helix	338-340	3
β-strand	344	1	6
α-helix	345-347	3

Chain B: 10 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	36-38	3	7
β-strand	41-43	3	7
β-strand	62-64	3	7
α-helix	72-74	3
α-helix	78-81	4
β-strand	87-89	3	7
β-strand	97	1	8
β-strand	108-110	3	7
β-strand	118	1	8
β-strand	119	1	9
α-helix	121-125	5
β-strand	132-134	3	7
β-strand	141	1	10
β-strand	145	1	9
α-helix	146	1
α-helix	149-151	3
β-strand	158-160	3	7
β-strand	165	1	10
β-strand	179-181	3	7
α-helix	192-195	4
β-strand	203-205	3	7
α-helix	213-215	3
β-strand	229-231	3	7
β-strand	239	1	11
β-strand	251-253	3	7
β-strand	261	1	11
β-strand	275-277	3	7
β-strand	299-301	3	7
β-strand	307-308	2	12
α-helix	311-313	3
α-helix	314-321	8
β-strand	328-330	3	7
β-strand	333	1	13
β-strand	334-336	3	12
β-strand	344	1	13
α-helix	345-347	3

Chain C: 12 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	36-38	3	14
β-strand	41-43	3	14
β-strand	62-64	3	14
α-helix	72-74	3
α-helix	78-81	4
β-strand	87-89	3	14
β-strand	108-110	3	14
β-strand	119	1	15
α-helix	121-125	5
β-strand	132-134	3	14
β-strand	141	1	16
β-strand	145	1	15
α-helix	146	1
α-helix	149-151	3
β-strand	158-160	3	14
β-strand	165	1	16
β-strand	179-181	3	14
α-helix	192-195	4
β-strand	203-205	3	14
α-helix	213-215	3
β-strand	229-231	3	14
β-strand	239	1	17
β-strand	251-253	3	14
β-strand	261	1	17
β-strand	275-277	3	14
α-helix	291-293	3
β-strand	299-301	3	14
β-strand	308	1	18
α-helix	311-313	3
α-helix	314-321	8
β-strand	328-330	3	14
β-strand	333	1	19
β-strand	336	1	18
α-helix	338-340	3
β-strand	344	1	19
α-helix	345-347	3

Chain D: 9 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	36-38	3	20
β-strand	41-43	3	20
β-strand	62-64	3	20
α-helix	72-74	3
α-helix	78-81	4
β-strand	87-89	3	20
β-strand	108-110	3	20
β-strand	119	1	21
α-helix	121-125	5
β-strand	132-134	3	20
β-strand	141	1	22
β-strand	145	1	21
α-helix	146	1
α-helix	149-151	3
β-strand	158-160	3	20
β-strand	165	1	22
β-strand	179-181	3	20
α-helix	192-195	4
β-strand	203-205	3	20
β-strand	229-231	3	20
β-strand	239	1	23
β-strand	251-253	3	20
β-strand	261	1	23
β-strand	275-277	3	20
β-strand	299-301	3	20
β-strand	308	1	24
α-helix	311-313	3
α-helix	314-321	8
β-strand	328-330	3	20
β-strand	333	1	25
β-strand	336	1	24
β-strand	344	1	25
α-helix	345-347	3

Chain E: 1 helix, 25 β-strands

Element	Residues	Length	Sheet
β-strand	141-150	10	26
β-strand	156-159	4	27
β-strand	169-173	5	27
β-strand	181-185	5	27
α-helix	188-192	5
β-strand	196-201	6	27
β-strand	206	1	28
β-strand	212-214	3	29
β-strand	217-221	5	29
β-strand	222	1	28
β-strand	227-232	6	29
β-strand	237-243	7	29
β-strand	247	1	30
β-strand	264-268	5	31
β-strand	271-277	7	31
β-strand	278	1	30
β-strand	284-290	7	31
β-strand	297-306	10	31
β-strand	312-316	5	32
β-strand	319-324	6	32
β-strand	338-344	7	32
β-strand	349-351	3	32
β-strand	355-356	2	32
β-strand	364-370	7	26
β-strand	375-380	6	26
β-strand	383-390	8	26

Chain F: 1 helix, 25 β-strands

Element	Residues	Length	Sheet
β-strand	141-150	10	33
β-strand	155-160	6	34
β-strand	169-174	6	34
β-strand	181-185	5	34
α-helix	188-192	5
β-strand	196-201	6	34
β-strand	206	1	35
β-strand	212-213	2	36
β-strand	217-221	5	36
β-strand	222	1	35
β-strand	227-232	6	36
β-strand	237-243	7	36
β-strand	247	1	37
β-strand	264-268	5	38
β-strand	271-277	7	38
β-strand	278	1	37
β-strand	284-290	7	38
β-strand	297-306	10	38
β-strand	310-316	7	39
β-strand	319-324	6	39
β-strand	338-344	7	39
β-strand	349-351	3	39
β-strand	355-356	2	39
β-strand	364-370	7	33
β-strand	375-380	6	33
β-strand	383-390	8	33

Chain G: 1 helix, 25 β-strands

Element	Residues	Length	Sheet
β-strand	141-150	10	40
β-strand	155-160	6	41
β-strand	169-174	6	41
β-strand	181-185	5	41
α-helix	188-192	5
β-strand	196-201	6	41
β-strand	206	1	42
β-strand	212-214	3	43
β-strand	217-221	5	43
β-strand	222	1	42
β-strand	227-232	6	43
β-strand	237-243	7	43
β-strand	247	1	44
β-strand	263-268	6	45
β-strand	271-277	7	45
β-strand	278	1	44
β-strand	284-290	7	45
β-strand	297-306	10	45
β-strand	310-316	7	46
β-strand	319-324	6	46
β-strand	338-344	7	46
β-strand	349-351	3	46
β-strand	355-356	2	46
β-strand	364-370	7	40
β-strand	375-380	6	40
β-strand	383-390	8	40

Chain H: 1 helix, 25 β-strands

Element	Residues	Length	Sheet
β-strand	141-150	10	47
β-strand	156-160	5	48
β-strand	169-173	5	48
β-strand	181-185	5	48
α-helix	188-192	5
β-strand	196-201	6	48
β-strand	206	1	49
β-strand	212-214	3	50
β-strand	217-221	5	50
β-strand	222	1	49
β-strand	227-232	6	50
β-strand	237-243	7	50
β-strand	247	1	51
β-strand	264-268	5	52
β-strand	271-277	7	52
β-strand	278	1	51
β-strand	284-290	7	52
β-strand	297-306	10	52
β-strand	310-316	7	53
β-strand	319-324	6	53
β-strand	338-344	7	53
β-strand	349-351	3	53
β-strand	355-356	2	53
β-strand	364-370	7	47
β-strand	375-380	6	47
β-strand	383-390	8	47

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leucine-rich repeat transmembrane protein FLRT3	A, B, C, D	protein	333	Homo sapiens	Q9NZU0 (AlphaFold model)
Latrophilin-3	E, F, G, H	protein	261	Homo sapiens	Q9HAR2 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5CMN_1 Leucine-rich repeat transmembrane protein FLRT3 (chains A, B, C, D)
ADPGKSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDATTLYLQNNQINNAGIPSDLKNLLK
VERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVS
IEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRL
VLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPP
NAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLP
VKVNVRGLMCQAPEKVRGMAIKDLNAELFDCKD

Sequence of entity 2 (E, F, G, H), FASTA

>5CMN_2 Latrophilin-3 (chains E, F, G, H)
VFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSSKDDF
IAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHD
TSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNPYTLRIEGTWDTAYDKRSAS
NAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSLVDVPFPNSYQYIAAVDYNP
RDNLLYVWNNYHVVKYSLDFG

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

Structural Basis of Latrophilin-FLRT-UNC5 Interaction in Cell Adhesion. Lu, Y.C., Nazarko, O.V., Sando, R. et al. Structure (2015) 23:1678-1691. DOI 10.1016/j.str.2015.06.024 · PubMed

Other PDB entries of the same protein (UniProt Q9NZU0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JBU 1.85 Å, High resolution crystal structure of human FLRT3 LRR domain in complex with mouse CIRL3…
5CMP 2.6 Å, human FLRT3 LRR domain

Browse structure collections

About this viewer

MolViewer shows 5CMN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.