High resolution crystal structure of human FLRT3 LRR domain in complex with mouse CIRL3 Olfactomedin like domain. Determined by X-ray diffraction at 1.85 Å resolution. Released 29 Jan 2020.
Explore 6JBU in 3D Show helices and sheets RCSB PDB PDBe
6JBU contains 15 α-helices and 50 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 206-218 | 13 | 1 |
| β-strand | 224-227 | 4 | 2 |
| β-strand | 237-241 | 5 | 2 |
| β-strand | 249-253 | 5 | 2 |
| α-helix | 256-261 | 6 | |
| β-strand | 266-269 | 4 | 2 |
| α-helix | 270 | 1 | |
| β-strand | 274 | 1 | 3 |
| β-strand | 280-282 | 3 | 4 |
| β-strand | 285-289 | 5 | 4 |
| β-strand | 290 | 1 | 3 |
| β-strand | 295-300 | 6 | 4 |
| β-strand | 305-311 | 7 | 4 |
| β-strand | 315 | 1 | 5 |
| β-strand | 332-336 | 5 | 6 |
| β-strand | 339-345 | 7 | 6 |
| β-strand | 346 | 1 | 5 |
| β-strand | 352-358 | 7 | 6 |
| β-strand | 365-374 | 10 | 6 |
| α-helix | 375-377 | 3 | |
| β-strand | 380-384 | 5 | 7 |
| β-strand | 387-392 | 6 | 7 |
| β-strand | 406-412 | 7 | 7 |
| β-strand | 417-424 | 8 | 7 |
| β-strand | 432-438 | 7 | 1 |
| β-strand | 443-448 | 6 | 1 |
| β-strand | 451-460 | 10 | 1 |
| α-helix | 462-463 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-38 | 3 | 8 |
| β-strand | 41-43 | 3 | 8 |
| α-helix | 52-53 | 2 | |
| β-strand | 62-64 | 3 | 8 |
| α-helix | 72-74 | 3 | |
| α-helix | 77-81 | 5 | |
| β-strand | 87-89 | 3 | 8 |
| β-strand | 108-110 | 3 | 8 |
| β-strand | 119 | 1 | 9 |
| α-helix | 121-125 | 5 | |
| β-strand | 132-134 | 3 | 8 |
| β-strand | 145 | 1 | 9 |
| α-helix | 146 | 1 | |
| β-strand | 158-160 | 3 | 8 |
| β-strand | 168 | 1 | 10 |
| α-helix | 169-170 | 2 | |
| β-strand | 179-181 | 3 | 8 |
| β-strand | 189 | 1 | 10 |
| β-strand | 190 | 1 | 11 |
| α-helix | 192-195 | 4 | |
| β-strand | 203-205 | 3 | 8 |
| β-strand | 216 | 1 | 11 |
| α-helix | 217 | 1 | |
| β-strand | 229-231 | 3 | 8 |
| β-strand | 239 | 1 | 12 |
| β-strand | 251-253 | 3 | 8 |
| β-strand | 261 | 1 | 12 |
| β-strand | 275-277 | 3 | 8 |
| β-strand | 299-301 | 3 | 8 |
| β-strand | 307-308 | 2 | 13 |
| α-helix | 311-313 | 3 | |
| α-helix | 314-321 | 8 | |
| β-strand | 328-330 | 3 | 8 |
| β-strand | 333 | 1 | 14 |
| β-strand | 334-336 | 3 | 13 |
| β-strand | 344 | 1 | 14 |
| α-helix | 345-347 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Adhesion G protein-coupled receptor L3 | A | protein | 276 | Mus musculus | Q80TS3 (AlphaFold model) |
| Leucine-rich repeat transmembrane protein FLRT3 | B | protein | 347 | Homo sapiens | Q9NZU0 (AlphaFold model) |
>6JBU_1 Adhesion G protein-coupled receptor L3 (chains A) APGDPRECPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSS KDDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANA NYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNPYTLRIEGTWDTAYDK RSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSLVDVPFPNSYQYIAAV DYNPRDNLLYVWNNYHVVKYSLDFGPAAAHHHHHHH
>6JBU_2 Leucine-rich repeat transmembrane protein FLRT3 (chains B) APGDPREKSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDATTLYLQNNQINNAGIPSDLKN LLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSVS AVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQGLTSL KRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINR VPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQ SLPVKVNVRGLMCQAPEKVRGMAIKDLNAELFDCKDSAAAHHHHHHH
Water and common crystallization additives (EDO, NA) are not listed.
High resolution crystal structure of human FLRT3 LRR domain in complex with mouse CIRL3 Olfactomedin like domain. Liu, H., Li, Z., Xu, F. To be published.
Other PDB entries of the same protein (UniProt Q80TS3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6JBU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.