mGluR3 complexed with glutamate analog. Determined by X-ray diffraction at 2.84 Å resolution. Released 9 Sept 2015.
Explore 5CNM in 3D Show helices and sheets RCSB PDB PDBe
5CNM contains 25 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 33-35 | 3 | 1 |
| β-strand | 39-45 | 7 | 1 |
| β-strand | 48-50 | 3 | 2 |
| α-helix | 51-52 | 2 | |
| β-strand | 57-60 | 4 | 2 |
| α-helix | 62-67 | 6 | |
| α-helix | 68-79 | 12 | |
| β-strand | 91-97 | 7 | 1 |
| α-helix | 102-116 | 15 | |
| β-strand | 142-146 | 5 | 1 |
| α-helix | 151-163 | 13 | |
| β-strand | 168-170 | 3 | 1 |
| α-helix | 176-179 | 4 | |
| β-strand | 187-189 | 3 | 1 |
| α-helix | 192-193 | 2 | |
| α-helix | 196-207 | 12 | |
| β-strand | 212-218 | 7 | 3 |
| α-helix | 221-236 | 16 | |
| β-strand | 240-247 | 8 | 3 |
| α-helix | 253-264 | 12 | |
| β-strand | 271-275 | 5 | 3 |
| α-helix | 278-290 | 13 | |
| β-strand | 296-299 | 4 | 3 |
| α-helix | 307-310 | 4 | |
| α-helix | 314-317 | 4 | |
| β-strand | 321-325 | 5 | 3 |
| α-helix | 331-338 | 8 | |
| α-helix | 351-359 | 9 | |
| β-strand | 362 | 1 | 4 |
| α-helix | 371 | 1 | |
| β-strand | 372 | 1 | 4 |
| α-helix | 373-374 | 2 | |
| α-helix | 390-411 | 22 | |
| α-helix | 420-423 | 4 | |
| α-helix | 427-429 | 3 | |
| α-helix | 430-434 | 5 | |
| α-helix | 435-437 | 3 | |
| β-strand | 440-441 | 2 | 5 |
| α-helix | 450-452 | 3 | |
| β-strand | 453-454 | 2 | 5 |
| β-strand | 456 | 1 | 6 |
| α-helix | 461 | 1 | |
| β-strand | 462 | 1 | 6 |
| α-helix | 463 | 1 | |
| β-strand | 466-471 | 6 | 3 |
| β-strand | 480-486 | 7 | 3 |
| β-strand | 490-492 | 3 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Metabotropic glutamate receptor 3 | A | protein | 517 | Homo sapiens | Q14832 (AlphaFold model) |
>5CNM_1 Metabotropic glutamate receptor 3 (chains A) MALKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECG RINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLT KVDEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKL SDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRN ISIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWV ASDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQK FQCSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKL CDAMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNVGGKY SYLKVGHWAETLSLDVNSIHWSRNSVPTSEGHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| 52Q | (1R,2S,4R,5R,6R)-2-amino-4-(1H-1,2,4-triazol-3-ylsulfanyl)bicyclo[3.1.0]hexane-… | C10 H12 N4 O4 S | 1 |
| MG | Magnesium ion | Mg | 1 |
Water and common crystallization additives (CL, SO4) are not listed.
Synthesis and Pharmacological Characterization of C4-(Thiotriazolyl)-substituted-2-aminobicyclo[3.1.0]hexane-2,6-dicarboxylates. Identification of (1R,2S,4R,5R,6R)-2-Amino-4-(1H-1,2,4-triazol-3-ylsulfanyl)bicyclo[3.1.0]hexane-2,6-dicarboxylic Acid (LY2812223), a Highly Potent, Functionally…. Monn, J.A., Prieto, L., Taboada, L. et al. J Med Chem (2015) 58:7526-7548. DOI 10.1021/acs.jmedchem.5b01124 · PubMed
Other PDB entries of the same protein (UniProt Q14832 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5CNM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.