5CNO: EGFR kinase domain mutant V924R

Crystal structure of the EGFR kinase domain mutant V924R. Determined by X-ray diffraction at 1.55 Å resolution. Released 29 Jul 2015.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Homo sapiens
Chains: 3
Atoms: 5,579
Mol. weight: 113.93 kDa
Ligands: ANP, MG
Released: 29 Jul 2015

Explore 5CNO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CNO contains 52 α-helices and 27 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	677-679	3
β-strand	681-682	2	1
α-helix	683-684	2
α-helix	685-687	3
β-strand	688-696	9	1
β-strand	700-707	8	1
β-strand	716-723	8	1
α-helix	724	1
α-helix	732-743	12
β-strand	747	1	2
β-strand	750	1	2
α-helix	751-753	3
β-strand	755-758	4	1
β-strand	762-766	5	1
β-strand	773	1	2
α-helix	774-780	7
α-helix	787-806	20
α-helix	816-818	3
β-strand	819-823	5	2
β-strand	826-829	4	2
α-helix	834-838	5
α-helix	854-856	3
α-helix	859-864	6
α-helix	869-884	16
α-helix	888-889	2
α-helix	896-898	3
α-helix	899-904	6
α-helix	909-912	4
β-strand	915	1	3
α-helix	917-926	10
α-helix	931-933	3
α-helix	935-936	2
α-helix	937-949	13
α-helix	951-954	4
β-strand	955	1	3
α-helix	960-962	3
α-helix	964-967	4
α-helix	968-978	11
α-helix	984-989	6

Chain B: 24 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	677-679	3
β-strand	681-682	2	4
α-helix	685-687	3
β-strand	688-696	9	4
β-strand	700-707	8	4
β-strand	716-723	8	4
α-helix	732-743	12
β-strand	747	1	5
β-strand	750	1	5
α-helix	751-753	3
β-strand	755-758	4	4
β-strand	762-766	5	4
β-strand	773	1	5
α-helix	774-780	7
α-helix	787-806	20
α-helix	816-818	3
β-strand	819-823	5	5
β-strand	826-829	4	5
α-helix	834-837	4
α-helix	854-856	3
α-helix	859-864	6
α-helix	869-884	16
α-helix	888-889	2
α-helix	896-898	3
α-helix	899-904	6
α-helix	909-912	4
β-strand	915	1	6
α-helix	917-926	10
α-helix	931-933	3
α-helix	935-936	2
α-helix	937-948	12
α-helix	951-954	4
β-strand	955	1	6
α-helix	960-962	3
α-helix	964-967	4
α-helix	968-978	11
α-helix	984-989	6

Chain X: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	995	1
β-strand	996	1	4
α-helix	997	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Epidermal growth factor receptor	A, B, X	protein	330	Homo sapiens	P00533 (AlphaFold model)

Sequence of entity 1 (A, B, X), FASTA

>5CNO_1 Epidermal growth factor receptor (chains A, B, X)
GAMGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATS
PKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQ
YLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAE
GGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGER
LPQPPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSP
TDSNFYRALMDEEDMDDVVDADEYLIPQQG

Ligands and cofactors

ID	Name	Formula	Copies
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	2
MG	Magnesium ion	Mg	2

Primary citation

Analysis of the Role of the C-Terminal Tail in the Regulation of the Epidermal Growth Factor Receptor. Kovacs, E., Das, R., Wang, Q. et al. Mol Cell Biol (2015) 35:3083-3102. DOI 10.1128/MCB.00248-15 · PubMed

Other PDB entries of the same protein (UniProt P00533 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8A27 1.07 Å, EGFR kinase domain in complex with 2-(6,7-dihydro-5H-pyrrolo[1,2-c]imidazol-1-yl)-2-[6-[2…
8A2D 1.11 Å, EGFR kinase domain (L858R/V948R) in complex with 2-[4-(difluoromethyl)-6-[2-[4-[[4-(hydro…
5UG9 1.33 Å, Crystal structure of the EGFR kinase domain (L858R, T790M, V948R) in complex with a…
5HG8 1.42 Å, EGFR (L858R, T790M, V948R) in complex with N-[3-({2-[(1-methyl-1H-pyrazol-4-yl)amino]-7H-…
8A2A 1.43 Å, EGFR kinase domain in complex with 2-(6,7-dihydro-5H-pyrrolo[1,2-c]imidazol-1-yl)-2-[6-[2…
5UG8 1.46 Å, Crystal structure of the EGFR kinase domain (L858R, T790M, V948R) in complex with a…
3POZ 1.5 Å, EGFR Kinase domain complexed with tak-285
6TFV 1.5 Å, Crystal Structure of EGFR T790M/V948R in Complex with Covalent Pyrrolopyrimidine 18b
6TG0 1.5 Å, Crystal Structure of EGFR T790M/V948R in Complex with Covalent Pyrrolopyrimidine 21a
3VRP 1.52 Å, Crystal structure of the tyrosine kinase binding domain of Cbl-c in complex with…
5HG5 1.52 Å, EGFR (L858R, T790M, V948R) in complex with N-{3-[(2-{[4-(4-methylpiperazin-1-yl)phenyl]am…
9NTP 1.55 Å, EGFR kinase domain (T790MV948R) in complex with a strain-release covalent inhibitor

Browse structure collections

About this viewer

MolViewer shows 5CNO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.