5CRB: SdeA DUB

Crystal Structure of SdeA DUB. Determined by X-ray diffraction at 2.0 Å resolution. Released 25 Nov 2015.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Legionella pneumophila
Chains: 2
Atoms: 3,219
Mol. weight: 41.95 kDa
Released: 25 Nov 2015

Explore 5CRB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CRB contains 26 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	12-13	2	1
β-strand	16-17	2	1
α-helix	19-29	11
α-helix	34-36	3
β-strand	37-40	4	2
β-strand	43-45	3	2
α-helix	48-54	7
β-strand	56-63	8	2
β-strand	64	1	3
β-strand	67	1	3
β-strand	71-77	7	2
β-strand	82-86	5	2
α-helix	91-102	12
α-helix	106	1
β-strand	110-113	4	2
α-helix	116-117	2
α-helix	125-128	4
α-helix	129-133	5
α-helix	134-140	7
α-helix	145-147	3
α-helix	148-163	16
α-helix	167-177	11
α-helix	191-199	9

Chain B: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	12-13	2	4
β-strand	16-17	2	4
α-helix	19-29	11
α-helix	34-36	3
β-strand	37-40	4	5
β-strand	43-45	3	5
α-helix	48-54	7
β-strand	56-63	8	5
β-strand	64	1	6
β-strand	67	1	6
β-strand	71-77	7	5
β-strand	82-86	5	5
α-helix	91-102	12
α-helix	106	1
β-strand	110-113	4	5
α-helix	116-117	2
α-helix	125-128	4
α-helix	129-133	5
α-helix	134-140	7
α-helix	145-147	3
α-helix	148-163	16
α-helix	167-177	11
α-helix	191-198	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SdeA	A, B	protein	193	Legionella pneumophila	Q6RCR0

Sequence of entity 1 (A, B), FASTA

>5CRB_1 SdeA (chains A, B)
MPKYVEGVELTQEGMHAIFARMGYGDITSGSIYNGVPTIDTGALNRQGFMPVLTGVGPHR
DSGHWIMLIKGPGNQYYLFDPLGKTSGEGYQNILAAQLPMGSTLSVIPNGSGLNMGLCGY
WVASAGLRAHQALNQHNPPTLLNVGQTITNEMRNELDHDGYRKITGWLRAVADEFPEGDP
QLDGKALRENTEK

Primary citation

Structural basis of substrate recognition by a bacterial deubiquitinase important for dynamics of phagosome ubiquitination. Sheedlo, M.J., Qiu, J., Tan, Y. et al. Proc Natl Acad Sci U S A (2015) 112:15090-15095. DOI 10.1073/pnas.1514568112 · PubMed

Other PDB entries of the same protein (UniProt Q6RCR0), best resolution first:

5CRA 2.64 Å, Structure of the SdeA DUB Domain
5CRC 2.85 Å, Structure of the SdeA DUB Domain
5YIK 3.1 Å, Structure of a Legionella effector with its substrate
5YIJ 3.18 Å, Structure of a Legionella effector with substrates
5YIM 3.39 Å, Structure of a Legionella effector

Browse structure collections

About this viewer

MolViewer shows 5CRB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.