5CSC: Open form of chicken heart citrate synthase

Structure of an open form of chicken heart citrate synthase at 2.8 Å resolution. Determined by X-ray diffraction at 2.8 Å resolution. Released 15 Apr 1991.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Gallus gallus
Chains: 2
Atoms: 6,606
Mol. weight: 94.3 kDa
Released: 15 Apr 1991

Explore 5CSC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CSC contains 55 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	7-26	20
β-strand	32-37	6	1
β-strand	59	1	2
β-strand	63	1	2
β-strand	65	1	3
β-strand	70	1	3
α-helix	71-77	7
β-strand	80	1	4
β-strand	87	1	4
α-helix	88	1
α-helix	89-98	10
α-helix	104-117	14
α-helix	122-129	8
α-helix	137-147	11
α-helix	148-151	4
α-helix	153-160	8
α-helix	164-166	3
α-helix	171-180	10
α-helix	182-194	13
α-helix	209-216	8
α-helix	222-234	13
α-helix	243-253	11
α-helix	258-262	5
α-helix	265-269	5
α-helix	277-290	14
α-helix	298-310	13
β-strand	318	1	5
α-helix	328-339	12
α-helix	345-363	19
β-strand	372	1	5
α-helix	379-382	4
α-helix	390-392	3
α-helix	393-400	8
α-helix	402-406	5
α-helix	409-415	7
α-helix	422-424	3
α-helix	427-432	6

Chain B: 27 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	7-24	18
α-helix	28-30	3
β-strand	32-37	6	1
α-helix	38-41	4
β-strand	57-59	3	6
β-strand	63-65	3	6
β-strand	70	1	6
α-helix	71-77	7
β-strand	80	1	7
β-strand	87	1	7
α-helix	89-98	10
α-helix	104-117	14
α-helix	122-128	7
α-helix	137-148	12
α-helix	153-160	8
α-helix	168-194	27
α-helix	209-214	6
α-helix	222-235	14
α-helix	243-250	8
α-helix	251-254	4
α-helix	262-269	8
α-helix	272-275	4
α-helix	277-280	4
α-helix	282-290	9
α-helix	298-310	13
β-strand	318	1	8
α-helix	328-337	10
α-helix	345-363	19
β-strand	372	1	8
α-helix	379-384	6
α-helix	393-400	8
α-helix	402-405	4
α-helix	409-415	7
α-helix	422-424	3
α-helix	427-432	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Citrate synthase	A	protein	433	Gallus gallus	P23007
Citrate synthase	B	protein	429	Gallus gallus	P23007

Sequence of entity 1 (A), FASTA

>5CSC_1 CITRATE SYNTHASE (chains A)
ASSTNLKDVLAALIPKEQARIKTFRQQHGGTALGQITVDMSYGGMRGMKGLVYETSVLDP
DEGIRFRGFSIPECQKLLPKGGXGGEPLPEGLFWLLVTGQIPTGAQVSWLSKEWAKRAAL
PSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGILRTKYWEMVYESAMDLIA
KLPCVAAKIYRNLYRAGSSIGAIDSKLDWSHNFTNMLGYTDAQFTELMRLYLTIHSDHEG
GNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLGWLAQLQKAXXXAGADAS
LRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPGDPMFKLVAQLYKIVPNV
LLEQGAAANPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLE
RPKSMSTDGLIAL

Sequence of entity 2 (B), FASTA

>5CSC_2 CITRATE SYNTHASE (chains B)
ASSTNLKDVLAALIPKEQARIKTFRQQHGGTALGQITVDMSYGGMRGMKGLVYETSVLDP
DEGIRFRGFSIPECQKLLPKGGGGEPLPEGLFWLLVTGQIPTGAQVSWLSKEWAKRAALP
SHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGILRTKYWEMVYESAMDLIAK
LPCVAAKIYRNLYRAGSSIGAIDSKLDWSHNFTNMLGYTDAQFTELMRLYLTIHSDHEGG
NVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLGWLAQLQKAAGADASLRDY
IWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPGDPMFKLVAQLYKIVPNVLLEQ
GAAANPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKS
MSTDGLIAL

Primary citation

Crystal structure of an open conformation of citrate synthase from chicken heart at 2.8-A resolution. Liao, D.-I., Karpusas, M., Remington, S.J. Biochemistry (1991) 30:6031-6036. DOI 10.1021/bi00238a029 · PubMed

Other PDB entries of the same protein (UniProt P23007), best resolution first:

1CSH 1.65 Å, A very short hydrogen bond provides only moderate stabilization of an enzyme: inhibitor…
1CSC 1.7 Å, Structure of ternary complexes of citrate synthase with D-and L-malate: Mechanistic…
1CSI 1.7 Å, A very short hydrogen bond provides only moderate stabilization of an enzyme: inhibitor…
1CSR 1.7 Å, Alpha-fluoro acid and alpha-fluoro amide analogs of acetyl-coa as inhibitors of of…
1CSS 1.7 Å, Alpha-fluoro acid and alpha-fluoro amide analogs of acetyl-CoA as inhibitors of of…
2CSC 1.7 Å, Structure of ternary complexes of CITRATE SYNTHASE WITH D-AND L-MALATE: mechanistic…
1AMZ 1.8 Å, Chicken citrate synthase complex with nitromethylde-CoA and malate
1AL6 1.85 Å, Chicken citrate synthase complex with N-hydroxyamido-CoA and oxaloacetate
3CSC 1.9 Å, Structure of ternary complexes of citrate synthase with D-and L-malate: mechanistic…
4CSC 1.9 Å, Structure of ternary complexes of citrate synthase with D-and L-malate: mechanistic…
5CTS 1.9 Å, Proposed mechanism for the condensation reaction of citrate synthase. 1.9-Å structure of…
6CSC 2.25 Å, Chicken citrate synthase complex with trifluoroacetonyl-CoA and citrate

Browse more

5CSC is part of these collections:

Metabolism and cellular energy

About this viewer

MolViewer shows 5CSC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.