X-ray crystal structure of SeMet human Sestrin2. Determined by X-ray diffraction at 3.5 Å resolution. Released 13 Jan 2016.
Explore 5CUF in 3D Show helices and sheets RCSB PDB PDBe
5CUF contains 140 α-helices and 10 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 68-72 | 5 | |
| α-helix | 78-83 | 6 | |
| α-helix | 87-102 | 16 | |
| α-helix | 109-121 | 13 | |
| α-helix | 126-138 | 13 | |
| α-helix | 143-147 | 5 | |
| α-helix | 149-151 | 3 | |
| α-helix | 154-157 | 4 | |
| α-helix | 159-168 | 10 | |
| α-helix | 170-172 | 3 | |
| α-helix | 175-181 | 7 | |
| α-helix | 188-190 | 3 | |
| α-helix | 191-214 | 24 | |
| α-helix | 232-235 | 4 | |
| α-helix | 257-270 | 14 | |
| α-helix | 281-283 | 3 | |
| α-helix | 284-292 | 9 | |
| α-helix | 310-315 | 6 | |
| α-helix | 334-336 | 3 | |
| β-strand | 337-338 | 2 | 1 |
| α-helix | 339-342 | 4 | |
| α-helix | 344-348 | 5 | |
| α-helix | 349-355 | 7 | |
| α-helix | 357-372 | 16 | |
| α-helix | 387-400 | 14 | |
| β-strand | 403-404 | 2 | 1 |
| α-helix | 412-416 | 5 | |
| α-helix | 419-430 | 12 | |
| α-helix | 437-441 | 5 | |
| α-helix | 450-476 | 27 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 68-72 | 5 | |
| α-helix | 78-83 | 6 | |
| α-helix | 87-102 | 16 | |
| α-helix | 109-121 | 13 | |
| α-helix | 126-138 | 13 | |
| α-helix | 143-147 | 5 | |
| α-helix | 149-151 | 3 | |
| α-helix | 154-157 | 4 | |
| α-helix | 159-168 | 10 | |
| α-helix | 170-172 | 3 | |
| α-helix | 175-180 | 6 | |
| α-helix | 188-190 | 3 | |
| α-helix | 191-214 | 24 | |
| α-helix | 232-235 | 4 | |
| α-helix | 257-268 | 12 | |
| α-helix | 281-283 | 3 | |
| α-helix | 284-292 | 9 | |
| α-helix | 310-315 | 6 | |
| α-helix | 334-336 | 3 | |
| β-strand | 337-338 | 2 | 2 |
| α-helix | 339-341 | 3 | |
| α-helix | 344-348 | 5 | |
| α-helix | 349-355 | 7 | |
| α-helix | 357-372 | 16 | |
| α-helix | 387-400 | 14 | |
| β-strand | 403-404 | 2 | 2 |
| α-helix | 412-416 | 5 | |
| α-helix | 419-430 | 12 | |
| α-helix | 437-441 | 5 | |
| α-helix | 449-476 | 28 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 68-72 | 5 | |
| α-helix | 78-83 | 6 | |
| α-helix | 87-102 | 16 | |
| α-helix | 109-121 | 13 | |
| α-helix | 126-138 | 13 | |
| α-helix | 143-147 | 5 | |
| α-helix | 149-151 | 3 | |
| α-helix | 154-157 | 4 | |
| α-helix | 159-168 | 10 | |
| α-helix | 170-172 | 3 | |
| α-helix | 175-181 | 7 | |
| α-helix | 188-190 | 3 | |
| α-helix | 191-214 | 24 | |
| α-helix | 232-235 | 4 | |
| α-helix | 257-268 | 12 | |
| α-helix | 281-283 | 3 | |
| α-helix | 284-292 | 9 | |
| α-helix | 310-315 | 6 | |
| α-helix | 334-336 | 3 | |
| β-strand | 337-338 | 2 | 3 |
| α-helix | 339-341 | 3 | |
| α-helix | 344-348 | 5 | |
| α-helix | 349-355 | 7 | |
| α-helix | 357-372 | 16 | |
| α-helix | 387-400 | 14 | |
| β-strand | 403-404 | 2 | 3 |
| α-helix | 412-416 | 5 | |
| α-helix | 419-430 | 12 | |
| α-helix | 437-441 | 5 | |
| α-helix | 449-476 | 28 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sestrin-2 | A, B, C, D, E | protein | 483 | Homo sapiens | P58004 (AlphaFold model) |
>5CUF_1 Sestrin-2 (chains A, B, C, D, E) SNAMIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREG AESLEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAI MAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEH IQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQ SSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLV TPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYP EGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLL ERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITR YMT
Janus-faced Sestrin2 controls ROS and mTOR signalling through two separate functional domains. Kim, H., An, S., Ro, S.H. et al. Nat Commun (2015) 6:10025-10025. DOI 10.1038/ncomms10025 · PubMed
Other PDB entries of the same protein (UniProt P58004 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5CUF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.