9LVJ: Sestrin2 bound human GATOR2 complex

Cryo-EM structure of Sestrin2 bound human GATOR2 complex. Determined by electron microscopy at 3.82 Å resolution. Released 13 Aug 2025.

Method: Electron microscopy
Resolution: 3.82 Å
Organism: Homo sapiens
Chains: 18
Atoms: 47,837
Mol. weight: 1263.95 kDa
Ligands: ZN
Released: 13 Aug 2025

Explore 9LVJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LVJ contains 245 α-helices and 505 β-strands across 18 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 29 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	1
β-strand	17-20	4	1
β-strand	25-29	5	1
β-strand	52-57	6	1
β-strand	65-68	4	2
α-helix	73	1
β-strand	77-81	5	2
β-strand	87-91	5	2
β-strand	107-108	2	2
β-strand	116-121	6	3
β-strand	128-133	6	3
β-strand	142-146	5	3
β-strand	179-181	3	3
β-strand	189-190	2	4
β-strand	199-203	5	4
β-strand	207-212	6	4
β-strand	219-223	5	4
β-strand	228	1	5
β-strand	239-244	6	5
β-strand	247-252	6	5
β-strand	256	1	6
β-strand	258	1	6
β-strand	261-262	2	5
α-helix	269	1
β-strand	270-275	6	7
β-strand	282-287	6	7
β-strand	293-297	5	7
β-strand	316-318	3	7
β-strand	327-330	4	8
β-strand	338-341	4	8
β-strand	347-350	4	8
β-strand	356-361	6	9
β-strand	365-370	6	9
β-strand	373-377	5	9
α-helix	390-399	10
α-helix	409-411	3
α-helix	412-415	4
α-helix	422-439	18
α-helix	455-459	5
α-helix	488-496	9
α-helix	509-517	9
α-helix	521-531	11
α-helix	534-546	13
α-helix	553-560	8
α-helix	561-563	3
α-helix	571-579	9
α-helix	586-596	11
α-helix	597-598	2
α-helix	603-606	4
α-helix	613-623	11
α-helix	630-643	14
α-helix	646-648	3
α-helix	649-652	4
α-helix	656-668	13
α-helix	673-679	7
α-helix	691-707	17
α-helix	710-722	13
β-strand	733-736	4	10
β-strand	743	1	10
β-strand	774	1	11
β-strand	781	1	11
α-helix	782-783	2
β-strand	784	1	12
β-strand	791	1	12
α-helix	820-822	3
β-strand	824-827	4	13
β-strand	832	1	14
β-strand	833	1	13
α-helix	836-845	10
α-helix	859-861	3

Chain B: 30 helices, 45 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	15
β-strand	17-20	4	15
β-strand	25-32	8	15
β-strand	43	1	15
β-strand	49-57	9	15
β-strand	65	1	16
β-strand	68	1	16
β-strand	77-81	5	16
β-strand	87-91	5	16
β-strand	107-108	2	16
β-strand	119-120	2	17
β-strand	129	1	18
β-strand	130-131	2	17
α-helix	134-136	3
β-strand	140-145	6	18
β-strand	177-183	7	18
β-strand	191-192	2	19
β-strand	199	1	20
β-strand	200-201	2	19
β-strand	202-203	2	21
β-strand	207-211	5	21
β-strand	212	1	20
β-strand	219-223	5	21
β-strand	231-232	2	22
β-strand	239-241	3	22
β-strand	244	1	23
β-strand	247	1	23
β-strand	249-252	4	22
β-strand	256	1	24
β-strand	258	1	24
β-strand	261-262	2	22
α-helix	263-265	3
α-helix	269	1
β-strand	270-275	6	25
β-strand	282-287	6	25
β-strand	293-297	5	25
β-strand	314-318	5	25
β-strand	327-330	4	26
β-strand	338-342	5	26
β-strand	346-350	5	26
β-strand	357-360	4	27
β-strand	365-370	6	27
β-strand	373-379	7	27
α-helix	390-399	10
α-helix	411-416	6
α-helix	421-437	17
α-helix	451-454	4
α-helix	456-461	6
α-helix	488-496	9
α-helix	509-518	10
α-helix	521-531	11
α-helix	534-546	13
α-helix	553-561	9
α-helix	571-579	9
α-helix	580-582	3
α-helix	586-596	11
α-helix	598	1
α-helix	603-606	4
α-helix	613-623	11
α-helix	626-643	18
α-helix	646-648	3
α-helix	649-652	4
α-helix	656-668	13
α-helix	673-679	7
α-helix	685-688	4
α-helix	691-706	16
α-helix	710-723	14
α-helix	728-730	3
β-strand	733-734	2	28
β-strand	738	1	29
α-helix	820-822	3
β-strand	824-826	3	30
β-strand	827	1	31
β-strand	833-835	3	30
α-helix	836-845	10

Chain C: 14 helices, 42 β-strands

Element	Residues	Length	Sheet
β-strand	22-24	3	32
β-strand	31-34	4	33
β-strand	40-44	5	33
β-strand	50-53	4	33
β-strand	60-64	5	33
β-strand	77-81	5	34
β-strand	89-94	6	34
β-strand	98	1	34
β-strand	101-103	3	34
β-strand	112	1	34
β-strand	123-126	4	35
β-strand	135-136	2	36
β-strand	138-140	3	35
β-strand	144-145	2	37
β-strand	148-149	2	36
β-strand	159-160	2	37
β-strand	167	1	38
β-strand	178-182	5	38
β-strand	187-192	6	38
β-strand	201-204	4	38
β-strand	210-214	5	39
β-strand	222-227	6	39
β-strand	231-236	6	39
β-strand	243-249	7	39
β-strand	254-257	4	40
α-helix	259-260	2
β-strand	266	1	41
β-strand	269-271	3	40
β-strand	278-280	3	40
β-strand	282	1	41
β-strand	291-293	3	40
β-strand	300-305	6	32
β-strand	314-318	5	32
β-strand	322-326	5	32
α-helix	335-337	3
β-strand	342-344	3	42
β-strand	351-356	6	42
α-helix	357-360	4
β-strand	395-400	6	42
α-helix	410-418	9
α-helix	426-438	13
α-helix	444-456	13
α-helix	630-632	3
α-helix	634-646	13
α-helix	650-660	11
α-helix	662-665	4
α-helix	670-686	17
α-helix	690-699	10
α-helix	708-710	3
β-strand	714	1	14
β-strand	716-719	4	10
β-strand	725	1	10
β-strand	742	1	43
β-strand	749	1	43
β-strand	753-756	4	13
α-helix	766-775	10

Chain D: 14 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	542-545	4	44
β-strand	549-552	4	44
β-strand	648-651	4	44
α-helix	660-665	6
α-helix	673-687	15
α-helix	692-702	11
α-helix	705-707	3
α-helix	719-721	3
α-helix	726-739	14
α-helix	743-752	10
α-helix	837-848	12
α-helix	853-855	3
α-helix	856-873	18
α-helix	876-882	7
α-helix	889-893	5
β-strand	896	1	29
β-strand	899-901	3	28
α-helix	902	1
β-strand	908-909	2	28
β-strand	913	1	45
β-strand	920	1	45
β-strand	923	1	46
β-strand	930	1	46
β-strand	934	1	31
α-helix	947-956	10

Chain E: 4 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	9
β-strand	15	1	47
β-strand	20	1	48
β-strand	27	1	48
β-strand	28-30	3	49
β-strand	31	1	47
β-strand	35-41	7	49
β-strand	47-54	8	49
β-strand	60-64	5	50
α-helix	68-70	3
β-strand	73	1	51
β-strand	75-78	4	50
β-strand	82-84	3	50
β-strand	86-87	2	51
β-strand	104-105	2	51
β-strand	109	1	50
β-strand	116-121	6	52
α-helix	124-126	3
β-strand	129-134	6	52
β-strand	138-143	6	52
β-strand	154-160	7	52
β-strand	168-170	3	53
α-helix	179-180	2
β-strand	182-184	3	53
β-strand	198-203	6	53
β-strand	208-214	7	53
β-strand	225-227	3	54
β-strand	236-240	5	54
β-strand	245-252	8	54
α-helix	263-265	3
β-strand	266-274	9	54
β-strand	281-286	6	55
β-strand	293-297	5	55
β-strand	302-307	6	55
β-strand	313-319	7	55

Chain F: 5 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	27
β-strand	15-19	5	56
β-strand	26-31	6	56
β-strand	36-41	6	56
β-strand	47-53	7	56
α-helix	59	1
β-strand	60-65	6	57
α-helix	68-70	3
β-strand	74-78	5	57
β-strand	83-90	8	57
β-strand	101-109	9	57
α-helix	115	1
β-strand	116-121	6	58
β-strand	129-134	6	58
β-strand	138-143	6	58
β-strand	154-160	7	58
β-strand	165-170	6	59
β-strand	182-186	5	59
β-strand	198-203	6	59
β-strand	208-214	7	59
α-helix	221-222	2
β-strand	225-227	3	60
β-strand	236-240	5	60
β-strand	245-252	8	60
α-helix	263-265	3
β-strand	266-274	9	60
β-strand	281-285	5	61
β-strand	292-297	6	61
β-strand	302-307	6	61
β-strand	313-319	7	61

Chain G: 5 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	42
β-strand	15-20	6	62
β-strand	26-31	6	62
β-strand	35-41	7	62
β-strand	47-53	7	62
β-strand	60-65	6	63
α-helix	68-70	3
β-strand	73	1	64
β-strand	74-78	5	63
β-strand	84	1	63
β-strand	87-89	3	64
β-strand	102-104	3	64
β-strand	108	1	63
β-strand	116-121	6	65
α-helix	122-123	2
β-strand	125	1	66
β-strand	127	1	66
β-strand	129-134	6	65
β-strand	138-143	6	65
β-strand	154-160	7	65
β-strand	165-170	6	67
β-strand	181-186	6	67
β-strand	198-202	5	67
β-strand	209-214	6	67
α-helix	221-222	2
β-strand	225-227	3	68
α-helix	228-229	2
β-strand	236-241	6	68
β-strand	245-250	6	68
α-helix	263-265	3
β-strand	268-274	7	68
β-strand	281-286	6	69
β-strand	292-297	6	69
β-strand	302-307	6	69
β-strand	313-319	7	69

Chain H: 3 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	52-53	2	44
α-helix	54-55	2
β-strand	67	1	70
β-strand	74	1	70
β-strand	82-83	2	71
α-helix	89-91	3
β-strand	99-100	2	71
β-strand	106	1	72
β-strand	119-123	5	73
β-strand	124	1	72
β-strand	129-135	7	73
β-strand	138-145	8	73
β-strand	152-157	6	74
β-strand	166-170	5	74
β-strand	175-177	3	74
β-strand	178-180	3	75
β-strand	186-188	3	75
β-strand	191	1	74
β-strand	199-204	6	76
β-strand	227-232	6	76
β-strand	237-241	5	76
β-strand	252-254	3	76
β-strand	263-266	4	77
β-strand	277-280	4	77
β-strand	288-290	3	77
β-strand	300-302	3	77
α-helix	305-307	3
β-strand	311-316	6	78
β-strand	322-327	6	78
β-strand	332-337	6	78
β-strand	343-345	3	78

10 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GATOR2 complex protein MIOS	A, B, K, L	protein	875	Homo sapiens	Q9NXC5 (AlphaFold model)
GATOR2 complex protein WDR24	C, M	protein	790	Homo sapiens	Q96S15 (AlphaFold model)
GATOR2 complex protein WDR59	D, N	protein	974	Homo sapiens	Q6PJI9 (AlphaFold model)
Isoform B of Nucleoporin SEH1	E, F, G, O, P, Q	protein	421	Homo sapiens	Q96EE3 (AlphaFold model)
Protein SEC13 homolog	H, R	protein	368	Homo sapiens	P55735
Sestrin-2	U, V	protein	480	Homo sapiens	P58004

Sequence of entity 1 (A, B, K, L), FASTA

>9LVJ_1 GATOR2 complex protein MIOS (chains A, B, K, L)
MSGTKPDILWAPHHVDRFVVCDSELSLYHVESTVNSELKAGSLRLSEDSAATLLSINSDT
PYMKCVAWYLNYDPECLLAVGQANGRVVLTSLGQDHNSKFKDLIGKEFVPKHARQCNTLA
WNPLDSNWLAAGLDKHRADFSVLIWDICSKYTPDIVPMEKVKLSAGETETTLLVTKPLYE
LGQNDACLSLCWLPRDQKLLLAGMHRNLAIFDLRNTSQKMFVNTKAVQGVTVDPYFHDRV
ASFYEGQVAIWDLRKFEKPVLTLTEQPKPLTKVAWCPTRTGLLATLTRDSNIIRLYDMQH
TPTPIGDETEPTIIERSVQPCDNYIASFAWHPTSQNRMIVVTPNRTMSDFTVFERISLAW
SPITSLMWACGRHLYECTEEENDNSLEKDIATKMRLRALSRYGLDTEQVWRNHILAGNED
PQLKSLWYTLHFMKQYTEDMDQKSPGNKGSLVYAGIKSIVKSSLGMVESSRHNWSGLDKQ
SDIQNLNEERILALQLCGWIKKGTDVDVGPFLNSLVQEGEWERAAAVALFNLDIRRAIQI
LNEGASSEKGDLNLNVVAMALSGYTDEKNSLWREMCSTLRLQLNNPYLCVMFAFLTSETG
SYDGVLYENKVAVRDRVAFACKFLSDTQLNRYIEKLTNEMKEAGNLEGILLTGLTKDGVD
LMESYVDRTGDVQTASYCMLQGSPLDVLKDERVQYWIENYRNLLDAWRFWHKRAEFDIHR
SKLDPSSKPLAQVFVSCNFCGKSISYSCSAVPHQGRGFSQYGVSGSPTKSKVTSCPGCRK
PLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHML
SWFRDHAECPVSACTCKCMQLDTTGNLVPAETVQP

Sequence of entity 2 (C, M), FASTA

>9LVJ_2 GATOR2 complex protein WDR24 (chains C, M)
MEKMSRVTTALGGSVLTGRTMHCHLDAPANAISVCRDAAQVVVAGRSIFKIYAIEEEQFV
EKLNLRVGRKPSLNLSCADVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHK
RTVNKVCFHPTEAHVLLSGSQDGFMKCFDLRRKDSVSTFSGQSESVRDVQFSIRDYFTFA
STFENGNVQLWDIRRPDRCERMFTAHNGPVFCCDWHPEDRGWLATGGRDKMVKVWDMTTH
RAKEMHCVQTIASVARVKWRPECRHHLATCSMMVDHNIYVWDVRRPFVPAAMFEEHRDVT
TGIAWRHPHDPSFLLSGSKDSSLCQHLFRDASQPVERANPEGLCYGLFGDLAFAAKESLV
AAESGRKPYTGDRRHPIFFKRKLDPAEPFAGLASSALSVFETEPGGGGMRWFVDTAERYA
LAGRPLAELCDHNAKVARELGRNQVAQTWTMLRIIYCSPGLVPTANLNHSVGKGGSCGLP
LMNSFNLKDMAPGLGSETRLDRSKGDARSDTVLLDSSATLITNEDNEETEGSDVPADYLL
GDVEGEEDELYLLDPEHAHPEDPECVLPQEAFPLRHEIVDTPPGPEHLQDKADSPHVSGS
EADVASLAPVDSSFSLLSVSHALYDSRLPPDFFGVLVRDMLHFYAEQGDVQMAVSVLIVL
GERVRKDIDEQTQEHWYTSYIDLLQRFRLWNVSNEVVKLSTSRAVSCLNQASTTLHVNCS
HCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGLFVWCQGCSHGGHLQHIMKWLEGSSHCP
AGCGHLCEYS

Sequence of entity 3 (D, N), FASTA

>9LVJ_3 GATOR2 complex protein WDR59 (chains D, N)
MAARWSSENVVVEFRDSQATAMSVDCLGQHAVLSGRRFLYIVNLDAPFEGHRKISRQSKW
DIGAVQWNPHDSFAHYFAASSNQRVDLYKWKDGSGEVGTTLQGHTRVISDLDWAVFEPDL
LVTSSVDTYIYIWDIKDTRKPTVALSAVAGASQVKWNKKNANCLATSHDGDVRIWDKRKP
STAVEYLAAHLSKIHGLDWHPDSEHILATSSQDNSVKFWDYRQPRKYLNILPCQVPVWKA
RYTPFSNGLVTVMVPQLRRENSLLLWNVFDLNTPVHTFVGHDDVVLEFQWRKQKEGSKDY
QLVTWSRDQTLRMWRVDSQMQRLCANDILDGVDEFIESISLLPEPEKTLHTEDTDHQHTA
SHGEEEALKEDPPRNLLEERKSDQLGLPQTLQQEFSLINVQIRNVNVEMDAADRSCTVSV
HCSNHRVKMLVKFPAQYPNNAAPSFQFINPTTITSTMKAKLLKILKDTALQKVKRGQSCL
EPCLRQLVSCLESFVNQEDSASSNPFALPNSVTPPLPTFARVTTAYGSYQDANIPFPRTS
GARFCGAGYLVYFTRPMTMHRAVSPTEPTPRSLSALSAYHTGLIAPMKIRTEAPGNLRLY
SGSPTRSEKEQVSISSFYYKERKSRRWKSKREGSDSGNRQIKAAGKVIIQDIACLLPVHK
SLGELYILNVNDIQETCQKNAASALLVGRKDLVQVWSLATVATDLCLGPKSDPDLETPWA
RHPFGRQLLESLLAHYCRLRDVQTLAMLCSVFEAQSRPQGLPNPFGPFPNRSSNLVVSHS
RYPSFTSSGSCSSMSDPGLNTGGWNIAGREAEHLSSPWGESSPEELRFGSLTYSDPRERE
RDQHDKNKRLLDPANTQQFDDFKKCYGEILYRWGLREKRAEVLKFVSCPPDPHKGIEFGV
YCSHCRSEVRGTQCAICKGFTFQCAICHVAVRGSSNFCLTCGHGGHTSHMMEWFRTQEVC
PTGCGCHCLLESTF

Sequence of entity 4 (E, F, G, O, P, Q), FASTA

>9LVJ_4 Isoform B of Nucleoporin SEH1 (chains E, F, G, O, P, Q)
MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSV
WRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVK
FAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSP
MIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAI
ATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDG
CVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGRYFF
TPLDSPRAGSRWSSYAQLLPPPPPPLVEHSCDADTANLQYPHPRRRYLSRPLNPLPENEG
I

Sequence of entity 5 (H, R), FASTA

>9LVJ_5 Protein SEC13 homolog (chains H, R)
MREPVLTWCVPLELLCSHPLPLSAFLKSQVKLYTYRACAGKDEMGKMVSVINTVDTSHED
MIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNIL
ASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTY
TGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLW
KEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWS
PKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASV
TEGQQNEQ

Sequence of entity 6 (U, V), FASTA

>9LVJ_6 Sestrin-2 (chains U, V)
MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAES
LEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAIMAA
ARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQA
LLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSP
PSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPS
ADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGG
QLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERN
LKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	32

Primary citation

Cryo-EM structures of amino acid sensors bound to the human GATOR2 complex. Su, M.Y., Teng, F., Wang, S. et al. Cell Rep (2025) 44:116088-116088. DOI 10.1016/j.celrep.2025.116088 · PubMed

Other PDB entries of the same protein (UniProt Q9NXC5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DX1 3.36 Å, Human GATOR2 complex - Sestrin2 bound state
9DX2 3.4 Å, Human GATOR2 complex - CASTOR1 bound state
9LWF 3.41 Å, Cryo-EM structure of dual sensor bound GATOR2 complex
9DX0 3.47 Å, Human GATOR2 complex - apo state
9OTI 3.5 Å, GATOR2 complex bound to arginine sensor CASTOR1
9LVK 3.59 Å, Cryo-EM structure of CASTOR1 bound human GATOR2 complex
7UHY 3.66 Å, Human GATOR2 complex

Browse structure collections

About this viewer

MolViewer shows 9LVJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.