Crystal Structure of Mouse Protocadherin-24 EC1-3. Determined by X-ray diffraction at 2.1 Å resolution. Released 2 Nov 2016.
Explore 5CYX in 3D Show helices and sheets RCSB PDB PDBe
5CYX contains 10 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-4 | 3 | |
| β-strand | 12-16 | 5 | 1 |
| α-helix | 19-20 | 2 | |
| β-strand | 24-27 | 4 | 2 |
| β-strand | 39-43 | 5 | 1 |
| α-helix | 47-49 | 3 | |
| β-strand | 50-52 | 3 | 2 |
| β-strand | 58-61 | 4 | 2 |
| β-strand | 72-80 | 9 | 1 |
| β-strand | 85-95 | 11 | 1 |
| α-helix | 96 | 1 | |
| β-strand | 103 | 1 | 3 |
| β-strand | 108-114 | 7 | 4 |
| β-strand | 122-125 | 4 | 5 |
| β-strand | 129 | 1 | 3 |
| α-helix | 134-137 | 4 | |
| β-strand | 139-147 | 9 | 4 |
| α-helix | 153-155 | 3 | |
| β-strand | 157-159 | 3 | 5 |
| β-strand | 164-167 | 4 | 5 |
| β-strand | 179-188 | 10 | 4 |
| β-strand | 191-193 | 3 | 6 |
| β-strand | 196-198 | 3 | 6 |
| β-strand | 201 | 1 | 4 |
| α-helix | 202-204 | 3 | |
| β-strand | 205-212 | 8 | 4 |
| α-helix | 213 | 1 | |
| β-strand | 219-221 | 3 | 7 |
| β-strand | 227-230 | 4 | 8 |
| α-helix | 234-235 | 2 | |
| β-strand | 239-242 | 4 | 9 |
| β-strand | 245-247 | 3 | 7 |
| β-strand | 256-263 | 8 | 8 |
| β-strand | 269-271 | 3 | 9 |
| β-strand | 276-279 | 4 | 9 |
| α-helix | 285-288 | 4 | |
| β-strand | 294-303 | 10 | 8 |
| β-strand | 314-323 | 10 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein Cdhr2 | A | protein | 337 | Mus musculus | E9Q7P9 (AlphaFold model) |
>5CYX_1 Protein Cdhr2 (chains A) MNSPPSFGVNMTLVTLPEDLPVGAVAFWLVATDSDNDHLTYGISGPNASYFSVNANTGEV KLASPLDFETVPFFKITISTSDGLNIRTAEMQVIVEDRNDNIPVFLNTEFSTSINETLPV GSVVFSVLAEDKDTGTAGLVQYFIEKVIPSTANSNNLFRILENGSIVLNDTLSYNNKSAF YQLELKACDSGGILDNKPKTQCSQPVFVSISVIDEPDLDPRFIREFYSASVAEDATLGTS VLTVEAVDSDKGINDIVTYSVSNSTRPGWFDIREDGVIFVNGSLDREQLLLENEEVQIQV TATEKNLNIYGQEAKASMWVTIRVTDVNDLEHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 5 |
Water and common crystallization additives (CL) are not listed.
Crystal Structure of Mouse Protocadherin-24 EC1-3. Johnson, Z.R., Sotomayor, M. To be published.
Other PDB entries of the same protein (UniProt E9Q7P9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5CYX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.