7X2E: USH1C PDZ2 and coiled-coil

Structure of USH1C PDZ2 and coiled-coil in complex with CDHR2 C-terminal tail. Determined by X-ray diffraction at 1.85 Å resolution. Released 6 Jul 2022.

Method: X-ray diffraction
Resolution: 1.85 Å
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 1,528
Mol. weight: 22.24 kDa
Released: 6 Jul 2022

Explore 7X2E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7X2E contains 5 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	210-214	5	1
β-strand	224-228	5	1
β-strand	236-241	6	1
α-helix	246-249	4
α-helix	256	1
β-strand	257-261	5	1
β-strand	264-265	2	1
α-helix	271-278	8
β-strand	284-289	6	1
α-helix	294-297	4
α-helix	300-367	68

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1305-1307	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Harmonin	A	protein	178	Homo sapiens	Q9Y6N9 (AlphaFold model)
Cadherin-related family member 2	B	protein	18	Mus musculus	E9Q7P9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7X2E_1 Harmonin (chains A)
GGVRGSLGSPGNRENKEKKVFISLVGSRGLGCSISSGPIQKPGIFISHVKPGSLSAEVGL
EIGDQIVEVNGVDFSNLDHKEAVNVLKSSRSLTISIVAAAGRELFMTDRERLAEARQREL
QRQELLMQKRLAMESNKILQEQQEMERQRRKEIAQKAAEENERYRKEMEQIVEEEEKF

Sequence of entity 2 (B), FASTA

>7X2E_2 Cadherin-related family member 2 (chains B)
QQKKNLSFTNPGLDTTDL

Primary citation

Structure of the Harmonin PDZ2 and coiled-coil domains in a complex with CDHR2 tail and its implications. Yan, W., Chen, G., Li, J. FASEB J (2022) 36:e22425-e22425. DOI 10.1096/fj.202200403RR · PubMed

Other PDB entries of the same protein (UniProt Q9Y6N9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5XBF 1.8 Å, Crystal Structure of Myo7b C-terminal MyTH4-FERM in complex with USH1C PDZ3
5MV8 1.88 Å, Structure of human Myosin 7b C-terminal MyTH4-FERM domain in complex with harmonin-a…
3K1R 2.3 Å, Structure of harmonin NPDZ1 in complex with the SAM-PBM of Sans
5MV9 2.6 Å, Structure of human Myosin 7a C-terminal MyTH4-FERM domain in complex with harmonin-a…
5F3X 2.65 Å, Crystal structure of Harmonin NPDZ1 in complex with ANKS4B SAM-PBM
1X5N Solution structure of the second PDZ domain of harmonin protein
2KBQ Solution structure of harmonin N terminal domain
2KBR Solution structure of harmonin N terminal domain in complex with a internal peptide of…
2KBS Solution structure of harmonin PDZ2 in complex with the carboxyl tail peptide of…
2LSR Solution structure of harmonin N terminal domain in complex with a exon68 encoded…

Browse structure collections

About this viewer

MolViewer shows 7X2E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.