Kazal type inhibitor from salivary glands of Aedes aegypti mosquito. Determined by X-ray diffraction at 1.4 Å resolution. Released 7 Sept 2016.
Explore 5DAE in 3D Show helices and sheets RCSB PDB PDBe
5DAE contains 7 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 14-16 | 3 | 1 |
| β-strand | 21-22 | 2 | 1 |
| α-helix | 25-32 | 8 | |
| α-helix | 35-38 | 4 | |
| β-strand | 44-46 | 3 | 1 |
| α-helix | 50-52 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-5 | 3 | |
| β-strand | 14-16 | 3 | 2 |
| β-strand | 21-22 | 2 | 2 |
| α-helix | 25-32 | 8 | |
| α-helix | 35-39 | 5 | |
| β-strand | 44-46 | 3 | 2 |
| α-helix | 51-53 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| AAEL006007-pa | A, B | protein | 65 | Aedes aegypti | Q177W0 (AlphaFold model) |
>5DAE_1 AAEL006007-PA (chains A, B) ERGVCACPRIYMPVCGSNLKTYNNDCLLRCEINSDLGRANNLRKIADQACDNLTDNVNDF IPQEY
High-resolution structure of a Kazal-type serine protease inhibitor from the dengue vector Aedes aegypti. Torquato, R.J.S., Lu, S., Martins, N.H. et al. Acta Crystallogr F Struct Biol Commun (2017) 73:469-475. DOI 10.1107/S2053230X17010007 · PubMed
Other PDB entries of the same protein (UniProt Q177W0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5DAE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.