7E50: Human microplasmin

Crystal structure of human microplasmin in complex with kazal-type inhibitor AaTI. Determined by X-ray diffraction at 1.95 Å resolution. Released 16 Feb 2022.

Method: X-ray diffraction
Resolution: 1.95 Å
Organisms: Aedes aegypti, Homo sapiens
Chains: 2
Atoms: 2,401
Mol. weight: 36.83 kDa
Released: 16 Feb 2022

Explore 7E50 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7E50 contains 12 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	10-12	3	1
β-strand	18-20	3	2
β-strand	25-26	2	2
α-helix	29-37	9
α-helix	39-43	5
β-strand	48-50	3	2

Chain B: 10 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	563	1	3
β-strand	566-567	2	1
α-helix	568-569	2
β-strand	576-581	6	4
β-strand	586-594	9	4
β-strand	597-600	4	4
α-helix	602-604	3
α-helix	611-613	3
β-strand	614-618	5	4
β-strand	622	1	5
β-strand	631-640	10	4
β-strand	648-652	5	4
α-helix	655-658	4
β-strand	659	1	6
β-strand	662	1	6
α-helix	664-665	2
β-strand	666	1	1
α-helix	667	1
α-helix	674-675	2
β-strand	679-684	6	1
β-strand	696	1	5
β-strand	698-705	8	1
α-helix	707-710	4
β-strand	724-727	4	1
β-strand	735	1	3
β-strand	744-749	6	1
β-strand	752-763	12	1
β-strand	772-776	5	1
α-helix	777-779	3
α-helix	781-789	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AAEL006007-pa	A	protein	79	Aedes aegypti	Q177W0 (AlphaFold model)
Plasminogen	B	protein	255	Homo sapiens	P00747 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7E50_1 AAEL006007-PA (chains A)
SGLEVLFQGPRSDAERGVCACPRIYMPVCGSNLKTYNNDCLLRCEINSDLGRANNLRKIA
DQACDNLTDNVNDFIPQEY

Sequence of entity 2 (B), FASTA

>7E50_2 Plasminogen (chains B)
SGLVPRGSSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPE
WVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPA
VITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFL
NGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVR
VSRFVTWIEGVMRNN

Primary citation

Crystal structure of Aedes aegypti trypsin inhibitor in complex with mu-plasmin reveals role for scaffold stability in Kazal-type serine protease inhibitor. Walvekar, V.A., Ramesh, K., Jobichen, C. et al. Protein Sci (2022) 31:470-484. DOI 10.1002/pro.4245 · PubMed

Other PDB entries of the same protein (UniProt Q177W0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5DAE 1.4 Å, Kazal type inhibitor from salivary glands of Aedes aegypti mosquito

Browse structure collections

About this viewer

MolViewer shows 7E50 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.