5DAY: NAP1-Related Protein(NRP1) in Arabidopsis

The structure of NAP1-Related Protein(NRP1) in Arabidopsis. Determined by X-ray diffraction at 2.33 Å resolution. Released 21 Sept 2016.

Method: X-ray diffraction
Resolution: 2.33 Å
Organism: Arabidopsis thaliana
Chains: 2
Atoms: 2,945
Mol. weight: 48.11 kDa
Ligands: CA
Released: 21 Sept 2016

Explore 5DAY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5DAY contains 19 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	19-74	56
α-helix	80-87	8
α-helix	89-92	4
α-helix	97-103	7
β-strand	106-113	8	1
β-strand	120-127	8	1
β-strand	133	1	2
β-strand	137-143	7	1
β-strand	151-154	4	1
α-helix	155-157	3
β-strand	159	1	2
α-helix	186-189	4
α-helix	206-210	5
α-helix	211-215	5
α-helix	220-223	4

Chain B: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	20-22	3
α-helix	25-74	50
α-helix	80-87	8
α-helix	89-92	4
α-helix	97-103	7
β-strand	106-113	8	3
α-helix	117-119	3
β-strand	120-127	8	3
β-strand	133	1	4
β-strand	137-143	7	3
β-strand	151-154	4	3
β-strand	159	1	4
α-helix	186-189	4
α-helix	206-209	4
α-helix	210-215	6
α-helix	220-224	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NAP1-related protein 1	A, B	protein	208	Arabidopsis thaliana	Q9CA59 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5DAY_1 NAP1-related protein 1 (chains A, B)
SNLEQIDAELVLSIEKLQEIQDDLEKINEKASDEVLEVEQKYNVIRKPVYDKRNEVIQSI
PGFWMTAFLSHPALGDLLTEEDQKIFKYLNSLEVEDAKDVKSGYSITFHFTSNPFFEDAK
LTKTFTFLEEGTTKITATPIKWKEGKGLPNGVNHDDKKGNKRALPEESFFTWFTDAQHKE
DAGDEIHDEVADIIKEDLWSNPLTYFNN

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3

Primary citation

The structure of NAP1-Related Protein(NRP1) in Arabidopsis. Zhu, Y., Rong, L., Yang, Y. et al. To be published.

Other PDB entries of the same protein (UniProt Q9CA59 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BP6 1.58 Å, Structural insights into nucleosome reorganization by NAP1-RELATED PROTEIN 1 (NRP1)
7C7X 3.0 Å, Structural insights into nucleosome reorganization by NAP1-RELATED PROTEIN 1 (NRP1)

Browse structure collections

About this viewer

MolViewer shows 5DAY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.