7BP6: Histone H2A.6

Structural insights into nucleosome reorganization by NAP1-RELATED PROTEIN 1 (NRP1). Determined by X-ray diffraction at 1.58 Å resolution. Released 11 Nov 2020.

Method: X-ray diffraction
Resolution: 1.58 Å
Organism: Arabidopsis thaliana
Chains: 3
Atoms: 1,569
Mol. weight: 21.91 kDa
Released: 11 Nov 2020

Explore 7BP6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BP6 contains 11 α-helices and 6 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	227-229	3
β-strand	231	1	3

Chain C: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	19-22	4
α-helix	29-38	10
β-strand	44-45	2	1
α-helix	49-74	26
β-strand	79-80	2	2
α-helix	82-90	9
α-helix	93-99	7
α-helix	101-103	3

Chain D: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	62-72	11
β-strand	77-78	2	2
β-strand	79	1	3
α-helix	80-107	28
β-strand	112-113	2	1
α-helix	115-125	11
α-helix	128-147	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone H2A.6	C	protein	93	Arabidopsis thaliana	Q9LD28 (AlphaFold model)
Histone H2B.1	D	protein	98	Arabidopsis thaliana	Q9LQQ4 (AlphaFold model)
NRP1-ctad	A	protein	7	Arabidopsis thaliana	Q9CA59 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>7BP6_1 Histone H2A.6 (chains C)
KKATSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELAGNAAR
DNKKTRIVPRHIQLAVRNDEELSKLLGDVTIAN

Sequence of entity 2 (D), FASTA

>7BP6_2 Histone H2B.1 (chains D)
KKRSKKNVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKK
PTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS

Sequence of entity 3 (A), FASTA

>7BP6_3 NRP1-CTAD (chains A)
DADEEDF

Primary citation

NAP1-Related Protein 1 (NRP1) has multiple interaction modes for chaperoning histones H2A-H2B. Luo, Q., Wang, B., Wu, Z. et al. Proc Natl Acad Sci U S A (2020) 117:30391-30399. DOI 10.1073/pnas.2011089117 · PubMed

Other PDB entries of the same protein (UniProt Q9LD28 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BP2 1.58 Å, Structural mechanism directing nucleosome reorganization by NAP1-RELATED PROTEIN 1 (NRP1)
7BP5 1.9 Å, Structural insights into nucleosome reorganization by NAP1-RELATED PROTEIN 1 (NRP1)
7BP4 2.1 Å, Structural insights into nucleosome reorganization by NAP1-RELATED PROTEIN 1 (NRP1)
7C7X 3.0 Å, Structural insights into nucleosome reorganization by NAP1-RELATED PROTEIN 1 (NRP1)
9K42 3.14 Å, Cryo-EM structure of Arabidopsis thaliana H2A-nucleosome with 147bp Widom 601 DNA (C2…
9K40 3.15 Å, Cryo-EM structure of Arabidopsis thaliana H2A-nucleosome with Arabidopsis native 147bp…
8KCB 3.17 Å, Complex of DDM1-nucleosome(H2A) complex with DDM1 bound to SHL2
8WHB 3.17 Å, Structure of nucleosome core particle of Arabidopsis thaliana
9K44 3.22 Å, Cryo-EM structure of Arabidopsis thaliana H2A-H3.3-nucleosome with Arabidopsis native…
8WH9 3.31 Å, Structure of DDM1-nucleosome complex in ADP-BeFx state
8WH5 3.58 Å, Structure of DDM1-nucleosome complex in the apo state
8WH8 3.6 Å, Structure of DDM1-nucleosome complex in ADP state

Browse structure collections

About this viewer

MolViewer shows 7BP6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.