5DQY: A fully oxidized human thioredoxin

A fully oxidized human thioredoxin. Determined by X-ray diffraction at 1.4 Å resolution. Released 23 Dec 2015.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 964
Mol. weight: 12 kDa
Ligands: BEZ
Released: 23 Dec 2015

Explore 5DQY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5DQY contains 4 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	1
α-helix	8-17	10
β-strand	23-28	6	1
α-helix	33-48	16
β-strand	53-58	6	1
α-helix	59-61	3
β-strand	76-81	6	1
β-strand	84-90	7	1
α-helix	94-104	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thioredoxin	A	protein	105	Homo sapiens	P10599 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5DQY_1 Thioredoxin (chains A)
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Ligands and cofactors

ID	Name	Formula	Copies
BEZ	Benzoic acid	C7 H6 O2	1

Water and common crystallization additives (GOL, CL) are not listed.

Primary citation

Crystal structure of fully oxidized human thioredoxin. Hwang, J., Nguyen, L.T., Jeon, Y.H. et al. Biochem Biophys Res Commun (2015) 467:218-222. DOI 10.1016/j.bbrc.2015.10.003 · PubMed

Other PDB entries of the same protein (UniProt P10599 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4OO4 0.97 Å, Crystal Structure of Human Thioredoxin Mutant
3M9J 1.1 Å, Crystal structure of human thioredoxin C69/73S double mutant, reduced form
2IFQ 1.2 Å, Crystal structure of S-nitroso thioredoxin
2HSH 1.35 Å, Crystal structure of C73S mutant of human thioredoxin-1 oxidized with H2O2
3M9K 1.5 Å, Crystal structure of human thioredoxin C69/73S double-mutant, oxidized form
4OO5 1.54 Å, Crystal Structure of S-nitrosated Human Thioredoxin Mutant
1ERV 1.65 Å, Human thioredoxin mutant with cys 73 replaced by ser (reduced form)
2HXK 1.65 Å, Crystal structure of S-nitroso thioredoxin
1ERT 1.7 Å, Human thioredoxin (reduced form)
2IIY 1.7 Å, Crystal structure of S-nitroso thioredoxin
3KD0 1.7 Å, Human thioredoxin C35S,C62S,C69S,C73S mutant showing cadmium chloride bound to the…
1ERW 1.8 Å, Human thioredoxin double mutant with cys 32 replaced by ser and cys 35 replaced by ser

Browse structure collections

About this viewer

MolViewer shows 5DQY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.