5DU1: Mambalgin-1

Crystal structure of Dendroaspis polylepis mambalgin-1 wild-type in P21 space group. Determined by X-ray diffraction at 1.8 Å resolution. Released 30 Dec 2015.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Dendroaspis polylepis polylepis
Chains: 4
Atoms: 2,054
Mol. weight: 26.3 kDa
Released: 30 Dec 2015

Explore 5DU1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5DU1 contains 9 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	9-11	3	1
α-helix	12-13	2
β-strand	18-27	10	2
β-strand	30-38	9	2
α-helix	43-45	3
β-strand	48-50	3	2

Chain B: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	3
β-strand	8-11	4	3
α-helix	12-13	2
β-strand	18-27	10	2
β-strand	30-38	9	2
α-helix	40-42	3
α-helix	43-48	6
β-strand	49-50	2	2

Chain C: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	4
β-strand	9-11	3	4
α-helix	12-13	2
β-strand	18-27	10	5
β-strand	30-38	9	5
α-helix	40-42	3
α-helix	43-48	6
β-strand	49-50	2	5

Chain D: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	6
β-strand	9-11	3	6
α-helix	12-13	2
β-strand	18-27	10	5
β-strand	30-38	9	5
β-strand	49-50	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mambalgin-1	A, B, C, D	protein	57	Dendroaspis polylepis polylepis	P0DKR6 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5DU1_1 Mambalgin-1 (chains A, B, C, D)
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK

Primary citation

Mambalgin-1 Pain-relieving Peptide, Stepwise Solid-phase Synthesis, Crystal Structure, and Functional Domain for Acid-sensing Ion Channel 1a Inhibition. Mourier, G., Salinas, M., Kessler, P. et al. J Biol Chem (2016) 291:2616-2629. DOI 10.1074/jbc.M115.702373 · PubMed

Other PDB entries of the same protein (UniProt P0DKR6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5DO6 1.7 Å, Crystal structure of Dendroaspis polylepis venom mambalgin-1 T23A mutant
5DZ5 1.95 Å, Crystal structure of Dendroaspis polylepis mambalgin-1 wild-type in P41212 space group
7ULB 2.49 Å, recombinant Mambalgin-1
7CFT 3.9 Å, Cryo-EM strucutre of human acid-sensing ion channel 1a in complex with snake toxin…
2MJY Solution structure of synthetic Mamba-1 peptide

Browse structure collections

About this viewer

MolViewer shows 5DU1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.