Crystal structure of Dendroaspis polylepis mambalgin-1 wild-type in P21 space group. Determined by X-ray diffraction at 1.8 Å resolution. Released 30 Dec 2015.
Explore 5DU1 in 3D Show helices and sheets RCSB PDB PDBe
5DU1 contains 9 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-4 | 3 | 1 |
| β-strand | 9-11 | 3 | 1 |
| α-helix | 12-13 | 2 | |
| β-strand | 18-27 | 10 | 2 |
| β-strand | 30-38 | 9 | 2 |
| α-helix | 43-45 | 3 | |
| β-strand | 48-50 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-5 | 4 | 3 |
| β-strand | 8-11 | 4 | 3 |
| α-helix | 12-13 | 2 | |
| β-strand | 18-27 | 10 | 2 |
| β-strand | 30-38 | 9 | 2 |
| α-helix | 40-42 | 3 | |
| α-helix | 43-48 | 6 | |
| β-strand | 49-50 | 2 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-4 | 3 | 4 |
| β-strand | 9-11 | 3 | 4 |
| α-helix | 12-13 | 2 | |
| β-strand | 18-27 | 10 | 5 |
| β-strand | 30-38 | 9 | 5 |
| α-helix | 40-42 | 3 | |
| α-helix | 43-48 | 6 | |
| β-strand | 49-50 | 2 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-4 | 3 | 6 |
| β-strand | 9-11 | 3 | 6 |
| α-helix | 12-13 | 2 | |
| β-strand | 18-27 | 10 | 5 |
| β-strand | 30-38 | 9 | 5 |
| β-strand | 49-50 | 2 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mambalgin-1 | A, B, C, D | protein | 57 | Dendroaspis polylepis polylepis | P0DKR6 (AlphaFold model) |
>5DU1_1 Mambalgin-1 (chains A, B, C, D) LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK
Mambalgin-1 Pain-relieving Peptide, Stepwise Solid-phase Synthesis, Crystal Structure, and Functional Domain for Acid-sensing Ion Channel 1a Inhibition. Mourier, G., Salinas, M., Kessler, P. et al. J Biol Chem (2016) 291:2616-2629. DOI 10.1074/jbc.M115.702373 · PubMed
Other PDB entries of the same protein (UniProt P0DKR6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5DU1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.