5DX1: CARM1, sinefungin, and PABP1 peptide
Crystal structure of CARM1, sinefungin, and PABP1 peptide (R455). Determined by X-ray diffraction at 1.93 Å resolution. Released 25 Nov 2015.
- Method
- X-ray diffraction
- Resolution
- 1.93 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 12,231
- Mol. weight
- 168.08 kDa
- Ligands
- SFG
- Released
- 25 Nov 2015
Explore 5DX1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5DX1 contains 68 α-helices and 86 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 17 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 136-140 | 5 | |
| α-helix | 143-153 | 11 | |
| α-helix | 156-164 | 9 | |
| α-helix | 166-178 | 13 | |
| α-helix | 180-182 | 3 | |
| β-strand | 187-191 | 5 | 1 |
| α-helix | 197-204 | 8 | |
| β-strand | 209-214 | 6 | 1 |
| α-helix | 218-228 | 11 | |
| β-strand | 235-239 | 5 | 1 |
| β-strand | 251-256 | 6 | 1 |
| β-strand | 260 | 1 | 2 |
| β-strand | 263 | 1 | 2 |
| α-helix | 268-274 | 7 | |
| α-helix | 275-278 | 4 | |
| β-strand | 279-286 | 8 | 1 |
| β-strand | 289-297 | 9 | 3 |
| α-helix | 300-310 | 11 | |
| α-helix | 311-314 | 4 | |
| β-strand | 318 | 1 | 4 |
| β-strand | 321 | 1 | 4 |
| α-helix | 324-326 | 3 | |
| α-helix | 327-335 | 9 | |
| α-helix | 338 | 1 | |
| β-strand | 339-341 | 3 | 3 |
| α-helix | 345-347 | 3 | |
| β-strand | 348 | 1 | 3 |
| α-helix | 351-352 | 2 | |
| β-strand | 353-358 | 6 | 3 |
| α-helix | 364-367 | 4 | |
| β-strand | 369-377 | 9 | 5 |
| β-strand | 382-396 | 15 | 3 |
| β-strand | 401-405 | 5 | 3 |
| β-strand | 417-428 | 12 | 3 |
| β-strand | 433-442 | 10 | 5 |
| β-strand | 448-456 | 9 | 5 |
| β-strand | 461-468 | 8 | 5 |
| β-strand | 473-474 | 2 | 3 |
Chain B: 16 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 136-140 | 5 | |
| α-helix | 143-153 | 11 | |
| α-helix | 156-163 | 8 | |
| α-helix | 166-178 | 13 | |
| α-helix | 180-182 | 3 | |
| β-strand | 187-191 | 5 | 6 |
| α-helix | 197-204 | 8 | |
| β-strand | 209-214 | 6 | 6 |
| α-helix | 218-228 | 11 | |
| β-strand | 235-239 | 5 | 6 |
| β-strand | 251-256 | 6 | 6 |
| β-strand | 260 | 1 | 7 |
| β-strand | 263 | 1 | 7 |
| α-helix | 269-274 | 6 | |
| α-helix | 275-278 | 4 | |
| β-strand | 279-286 | 8 | 6 |
| β-strand | 289-297 | 9 | 8 |
| α-helix | 300-310 | 11 | |
| α-helix | 311-313 | 3 | |
| β-strand | 318 | 1 | 9 |
| β-strand | 321 | 1 | 9 |
| α-helix | 324-326 | 3 | |
| α-helix | 327-335 | 9 | |
| β-strand | 339-341 | 3 | 8 |
| α-helix | 345-347 | 3 | |
| β-strand | 348 | 1 | 8 |
| α-helix | 351-352 | 2 | |
| β-strand | 353-358 | 6 | 8 |
| α-helix | 364-367 | 4 | |
| β-strand | 369-377 | 9 | 10 |
| β-strand | 382-396 | 15 | 8 |
| β-strand | 401-405 | 5 | 8 |
| β-strand | 417-428 | 12 | 8 |
| β-strand | 433-443 | 11 | 10 |
| β-strand | 447-456 | 10 | 10 |
| β-strand | 462-468 | 7 | 10 |
| β-strand | 473-474 | 2 | 8 |
Chain C: 16 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 136-140 | 5 | |
| α-helix | 143-153 | 11 | |
| α-helix | 156-163 | 8 | |
| α-helix | 166-178 | 13 | |
| α-helix | 180-182 | 3 | |
| β-strand | 187-191 | 5 | 11 |
| α-helix | 197-204 | 8 | |
| β-strand | 209-214 | 6 | 11 |
| α-helix | 218-228 | 11 | |
| β-strand | 235-239 | 5 | 11 |
| β-strand | 251-256 | 6 | 11 |
| β-strand | 260 | 1 | 12 |
| β-strand | 263 | 1 | 12 |
| α-helix | 268-274 | 7 | |
| α-helix | 275-278 | 4 | |
| β-strand | 279-286 | 8 | 11 |
| β-strand | 289-297 | 9 | 13 |
| α-helix | 300-310 | 11 | |
| α-helix | 311-314 | 4 | |
| β-strand | 318 | 1 | 14 |
| β-strand | 321 | 1 | 14 |
| α-helix | 324-326 | 3 | |
| α-helix | 327-335 | 9 | |
| β-strand | 339-341 | 3 | 13 |
| α-helix | 345-347 | 3 | |
| β-strand | 348 | 1 | 13 |
| α-helix | 351-352 | 2 | |
| β-strand | 353-358 | 6 | 13 |
| α-helix | 364-367 | 4 | |
| β-strand | 369-377 | 9 | 15 |
| β-strand | 382-396 | 15 | 13 |
| β-strand | 401-405 | 5 | 13 |
| β-strand | 417-428 | 12 | 13 |
| β-strand | 433-442 | 10 | 15 |
| β-strand | 448-456 | 9 | 15 |
| β-strand | 461-468 | 8 | 15 |
| β-strand | 473-474 | 2 | 13 |
Chain D: 15 helices, 23 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 136-140 | 5 | |
| α-helix | 143-153 | 11 | |
| α-helix | 156-163 | 8 | |
| α-helix | 166-178 | 13 | |
| α-helix | 180-182 | 3 | |
| β-strand | 187-191 | 5 | 16 |
| α-helix | 197-204 | 8 | |
| β-strand | 209-214 | 6 | 16 |
| α-helix | 218-228 | 11 | |
| β-strand | 235-239 | 5 | 16 |
| β-strand | 251-256 | 6 | 16 |
| β-strand | 260 | 1 | 17 |
| β-strand | 263 | 1 | 17 |
| α-helix | 268-274 | 7 | |
| α-helix | 275-278 | 4 | |
| β-strand | 279-286 | 8 | 16 |
| β-strand | 289-297 | 9 | 18 |
| α-helix | 300-310 | 11 | |
| α-helix | 311-313 | 3 | |
| β-strand | 318 | 1 | 19 |
| β-strand | 321 | 1 | 19 |
| α-helix | 324-326 | 3 | |
| α-helix | 327-335 | 9 | |
| β-strand | 339-341 | 3 | 18 |
| α-helix | 345-347 | 3 | |
| β-strand | 348 | 1 | 18 |
| β-strand | 350 | 1 | 20 |
| β-strand | 353-358 | 6 | 18 |
| α-helix | 364-367 | 4 | |
| β-strand | 369-377 | 9 | 21 |
| β-strand | 378 | 1 | 20 |
| β-strand | 382-396 | 15 | 18 |
| β-strand | 401-405 | 5 | 18 |
| β-strand | 417-428 | 12 | 18 |
| β-strand | 433-442 | 10 | 21 |
| β-strand | 448-456 | 9 | 21 |
| β-strand | 461-468 | 8 | 21 |
| β-strand | 473-474 | 2 | 18 |
Chain F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-11 | 4 | |
Chain G: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-12 | 5 | |
Chain H: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-10 | 3 | |
Chain I: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-13 | 6 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Histone-arginine methyltransferase CARM1 | A, B, C, D | protein | 349 | Homo sapiens | Q86X55 (AlphaFold model) |
| PABP1 peptide | F, G, H, I | protein | 19 | Homo sapiens | P11940 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>5DX1_1 Histone-arginine methyltransferase CARM1 (chains A, B, C, D)
SIARSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLD
VGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQ
VDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKA
NFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRI
EIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKA
GDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGT
Sequence of entity 2 (F, G, H, I), FASTA
>5DX1_2 PABP1 peptide (chains F, G, H, I)
NMPGAIRPAAPRPPFSTMX
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| SFG | Sinefungin | C15 H23 N7 O5 | 4 |
Water and common crystallization additives (GOL) are not listed.
Primary citation
Structural Insights into Ternary Complex Formation of Human CARM1 with Various Substrates. Boriack-Sjodin, P.A., Jin, L., Jacques, S.L. et al. ACS Chem Biol (2016) 11:763-771. DOI 10.1021/acschembio.5b00773 · PubMed
Other PDB entries of the same protein (UniProt Q86X55 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8G2H 1.49 Å, Crystal Structure of PRMT4 with Compound YD1113
- 6DVR 1.54 Å, Crystal structure of human CARM1 with (R)-SKI-72
- 8SIG 1.78 Å, Crystal Structure of PRMT4 with Compound YD1-288
- 6S7A 1.86 Å, Crystal structure of CARM1 in complex with inhibitor AA175
- 8UQH 1.87 Å, X-ray crystal structure of PRMT4 bound to compound YD-1130
- 5U4X 1.88 Å, Coactivator-associated arginine methyltransferase 1 with TP-064
- 6ARJ 1.92 Å, Crystal structure of CARM1 with EPZ022302 and SAH
- 5DX8 1.94 Å, Crystal structure of CARM1, sinefungin, and methylated PABP1 peptide (R455)
- 5DXJ 1.95 Å, Crystal structure of CARM1 and sinefungin
- 9O6H 1.97 Å, The Structure of PRMT4 in complex with SGC8172
- 4IKP 2.0 Å, Crystal structure of coactivator-associated arginine methyltransferase 1 with…
- 6ARV 2.0 Å, Crystal structure of CARM1 with Compound 2 and SAH
Browse structure collections
About this viewer
MolViewer shows 5DX1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.