5DXE: Estrogen receptor

Estrogen Receptor Alpha Ligand Binding Domain Y537S Mutant in Complex with Stapled Peptide SRC2-P4 and Estradiol. Determined by X-ray diffraction at 1.5 Å resolution. Released 3 Aug 2016.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,363
Mol. weight: 63.2 kDa
Ligands: EST
Released: 3 Aug 2016

Explore 5DXE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5DXE contains 25 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	312-322	11
α-helix	323-329	7
α-helix	339-361	23
α-helix	367-369	3
α-helix	372-394	23
β-strand	402-405	4	1
β-strand	408-410	3	1
α-helix	412-415	4
α-helix	421-438	18
α-helix	442-455	14
α-helix	458-460	3
α-helix	473-492	20
α-helix	497-530	34
α-helix	538-545	8

Chain B: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	312-321	10
α-helix	323-328	6
α-helix	339-361	23
α-helix	367-369	3
α-helix	372-395	24
β-strand	401-405	5	2
β-strand	408-411	4	2
α-helix	412-417	6
α-helix	421-438	18
α-helix	442-455	14
α-helix	473-492	20
α-helix	497-530	34
α-helix	538-545	8

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Estrogen receptor	A, B	protein	261	Homo sapiens	P03372 (AlphaFold model)
Nuclear receptor coactivator 2	C, D	protein	13	Homo sapiens	Q15596 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5DXE_1 Estrogen receptor (chains A, B)
MDPMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRE
LVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRN
QGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKD
HIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNV
VPLSDLLLEMLDAHRLHAPTS

Sequence of entity 2 (C, D), FASTA

>5DXE_2 Nuclear receptor coactivator 2 (chains C, D)
XHKLLHRLLQDSX

Ligands and cofactors

ID	Name	Formula	Copies
EST	Estradiol	C18 H24 O2	2

Primary citation

Stapled Peptides with gamma-Methylated Hydrocarbon Chains for the Estrogen Receptor/Coactivator Interaction. Speltz, T.E., Fanning, S.W., Mayne, C.G. et al. Angew Chem Int Ed Engl (2016) 55:4252-4255. DOI 10.1002/anie.201510557 · PubMed

Other PDB entries of the same protein (UniProt P03372 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BAA 1.1 Å, Cys-42-tethered stabilizer 12 of 14-3-3(sigma)/ERa PPI
8BZC 1.1 Å, co-soaked stabilizers for ERa - 14-3-3 interaction (884_AZ244)
8BZW 1.1 Å, Co-soaked stabilizers for ERa - 14-3-3 interaction (844_AZ210)
8C04 1.1 Å, Co-soaked stabilizers for ERa - 14-3-3 interaction (884_AZ354)
7B9R 1.15 Å, Cys-45-tethered stabilizer 4 of 14-3-3(sigma)/ERa PPI
7B9T 1.15 Å, Cys-45-tethered stabilizer 5 of 14-3-3(sigma)/ERa PPI
7NFW 1.19 Å, Human 14-3-3 sigma in complex with human Estrogen Receptor alpha peptide
6HMU 1.2 Å, Ternary complex of Estrogen Receptor alpha peptide and 14-3-3 sigma C45 mutant bound to…
7BA8 1.2 Å, Cys-42-tethered stabilizer 10 of 14-3-3(sigma)/ERa PPI
8APS 1.2 Å, Small molecular stabilizer for ERalpha and 14-3-3 (1083744)
8BX3 1.2 Å, fragment-linked stabilizer for ERa - 14-3-3 interaction (1074372)
8BXI 1.2 Å, fragment-linked stabilizer for ERa - 14-3-3 interaction (1074361)

Browse structure collections

About this viewer

MolViewer shows 5DXE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.