5E5B: Human Spt16 N-terminal domain

Crystal structure of Human Spt16 N-terminal domain. Determined by X-ray diffraction at 1.84 Å resolution. Released 10 Feb 2016.

Method: X-ray diffraction
Resolution: 1.84 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,878
Mol. weight: 48.72 kDa
Released: 10 Feb 2016

Explore 5E5B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5E5B contains 28 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	7-23	17
α-helix	26-28	3
β-strand	33-38	6	1
α-helix	48-57	10
β-strand	64-68	5	1
β-strand	73-77	5	1
α-helix	79-89	11
α-helix	95-99	5
α-helix	101-102	2
β-strand	103-107	5	1
α-helix	108-109	2
α-helix	115-127	13
β-strand	133-136	4	1
α-helix	145-155	11
α-helix	159	1
β-strand	160-163	4	1
α-helix	165-173	9
α-helix	175-176	2
α-helix	177-192	16
α-helix	193-198	6
α-helix	199-207	9
β-strand	213	1	2
α-helix	214-224	11
α-helix	228-230	3
α-helix	236-238	3
β-strand	239-241	3	3
β-strand	246-248	3	4
β-strand	265	1	2
α-helix	266-267	2
β-strand	270-275	6	4
β-strand	277-279	3	3
β-strand	282-283	2	3
β-strand	286-292	7	4
α-helix	296-315	20
β-strand	321	1	5
α-helix	322-336	15
α-helix	338-340	3
β-strand	344	1	4
β-strand	349-351	3	4
β-strand	358-362	5	4
α-helix	369	1
β-strand	370	1	5
α-helix	371	1
β-strand	376-387	12	4
α-helix	394-397	4
β-strand	398-408	11	4
α-helix	415	1
β-strand	416-417	2	4
α-helix	425-428	4
β-strand	429-430	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FACT complex subunit SPT16	A	protein	431	Homo sapiens	Q9Y5B9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5E5B_1 FACT complex subunit SPT16 (chains A)
AVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYEL
TDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKM
IEAIKESKNGKKIGVFSKDKFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGELN
LMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEM
CYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPSQEVQEN
YNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGFGMGIEFREGSL
VINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTSV
KKKVKNVGIFL

Primary citation

Structure of the human histone chaperone FACT Spt16 N-terminal domain. Marciano, G., Huang, D.T. Acta Crystallogr F Struct Biol Commun (2016) 72:121-128. DOI 10.1107/S2053230X15024565 · PubMed

Other PDB entries of the same protein (UniProt Q9Y5B9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UMU 1.9 Å, Crystal structure of the middle double PH domain of human FACT complex subunit SPT16
4Z2N 1.92 Å, Crystal structure of human FACT SPT16 middle domain
8I17 1.98 Å, Structural basis for H2A-H2B recognitions by human Spt16
5UMT 2.09 Å, Crystal structure of N-terminal domain of human FACT complex subunit SPT16
5XM2 2.19 Å, Human N-terminal domain of FACT complex subunit SPT16
4Z2M 2.98 Å, Crystal structure of human SPT16 Mid-AID/H3-H4 tetramer FACT Histone complex
9EH2 3.1 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-FACT nucleosome upstream
9RZC 3.66 Å, State 3 MAP 1 SETD2 bound to distal H3 of upstream nucleosome
8YJM 4.15 Å, Structure of human SPT16 MD-CTD and MCM2 HBD chaperoning a histone H3-H4 tetramer and a…
8YJF 4.4 Å, Structure of human SPT16 MD-CTD and MCM2 HBD chaperoning a histone H3-H4 tetramer and an…
9GW2 4.84 Å, State 2 MAP 1 SETD2 bound to proximal H3 of upstream nucleosome
6UPK 4.9 Å, Structure of FACT_subnucleosome complex 1

Browse structure collections

About this viewer

MolViewer shows 5E5B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.