Structure of Influenza B Lee PB2 cap-binding domain bound to m7GTP. Determined by X-ray diffraction at 1.9 Å resolution. Released 18 Nov 2015.
Explore 5EFA in 3D Show helices and sheets RCSB PDB PDBe
5EFA contains 8 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 323-324 | 2 | |
| β-strand | 325-327 | 3 | 1 |
| β-strand | 330-337 | 8 | 1 |
| β-strand | 340-347 | 8 | 2 |
| β-strand | 353-360 | 8 | 2 |
| β-strand | 363-369 | 7 | 1 |
| β-strand | 372-379 | 8 | 1 |
| β-strand | 382-389 | 8 | 1 |
| α-helix | 393-406 | 14 | |
| α-helix | 410-414 | 5 | |
| β-strand | 423 | 1 | 3 |
| α-helix | 428 | 1 | |
| β-strand | 429 | 1 | 3 |
| α-helix | 430-431 | 2 | |
| α-helix | 432-441 | 10 | |
| α-helix | 444-451 | 8 | |
| β-strand | 453-455 | 3 | 4 |
| α-helix | 456-457 | 2 | |
| β-strand | 462-463 | 2 | 1 |
| β-strand | 465 | 1 | 5 |
| β-strand | 471 | 1 | 5 |
| β-strand | 474-476 | 3 | 4 |
| β-strand | 479-482 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polymerase basic protein 2 | A | protein | 174 | Influenza B virus | Q9QLL6 (AlphaFold model) |
>5EFA_1 Polymerase basic protein 2 (chains A) MKIRQRQRFGRLELKRISGRGFKNDEEILIGNGTIQKIGIWDGEEEFHVRCGECRGILKK SQMRMEKLLINSAKKEDMKDLIILCMVFSQDTRMFQGVRGEINFLNRAGQLLSPMYQLQR YFLNRSNDLFDQWGYEESPKASELHGINELMNASDYTLKGVVVTKNVDHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| MGT | 7N-methyl-8-hydroguanosine-5'-triphosphate | C11 H20 N5 O14 P3 | 1 |
Molecular Basis of mRNA Cap Recognition by Influenza B Polymerase PB2 Subunit. Xie, L., Wartchow, C., Shia, S. et al. J Biol Chem (2016) 291:363-370. DOI 10.1074/jbc.M115.693051 · PubMed
Other PDB entries of the same protein (UniProt Q9QLL6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5EFA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.