5ELI: Triggering receptor expressed on myeloid cells 2

Triggering receptor expressed on myeloid cells 2. Determined by X-ray diffraction at 3.1 Å resolution. Released 28 Dec 2016.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,784
Mol. weight: 28.74 kDa
Ligands: NAG
Released: 28 Dec 2016

Explore 5ELI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5ELI contains 3 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	22-27	6	1
β-strand	32-37	6	2
β-strand	47-53	7	1
β-strand	60-65	6	1
α-helix	70-72	3
β-strand	77-79	3	2
β-strand	82-87	6	2
β-strand	92-97	6	2
β-strand	106-114	9	1
β-strand	117-129	13	1

Chain B: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	22-27	6	3
β-strand	32-37	6	4
β-strand	47-53	7	3
β-strand	60-65	6	3
α-helix	70-72	3
β-strand	77-79	3	4
β-strand	82-87	6	4
β-strand	92-97	6	4
α-helix	102-104	3
β-strand	106-114	9	3
β-strand	117-129	13	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Triggering receptor expressed on myeloid cells 2	A, B	protein	126	Homo sapiens	Q9NZC2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5ELI_1 Triggering receptor expressed on myeloid cells 2 (chains A, B)
TGHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLR
RWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLGTK
HHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Neurodegenerative disease mutations in TREM2 reveal a functional surface and distinct loss-of-function mechanisms. Kober, D.L., Alexander-Brett, J.M., Karch, C.M. et al. Elife (2016) 5. DOI 10.7554/eLife.20391 · PubMed

Other PDB entries of the same protein (UniProt Q9NZC2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
5UD8 1.8 Å, Crystal Structure of Mutant Ig-like Domain
9PWN 1.8 Å, Crystal structure of Fabs 7411 in complex with TREM2 peptide
8T51 1.9 Å, Crystal structure of Fab 3.10C2 bound to TREM2
8T59 2.0 Å, Crystal structure of Para.09 bound to TREM2
6B8O 2.2 Å, WT Ig-like V Domain with Phosphatidylserine
5UD7 2.2 Å, Crystal Structure of Wild-Type Ig-like Domain
6Y6C 2.26 Å, TREM2 extracellular domain (19-174) in complex with single-chain variable fragment…
6YMQ 3.07 Å, TREM2 extracellular domain (19-131) in complex with single-chain variable 4 (scFv-4)
6YYE 3.36 Å, TREM2 extracellular domain (19-131) in complex with single-chain variable fragment…
9PX5 3.7 Å, Crystal structure of Fab 7268 in complex with MBP-TREM2 Ig domain fusion
6Z0G Structure of TREM2 transmembrane helix in DPC micelles

Browse structure collections

About this viewer

MolViewer shows 5ELI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.