5EP6: NAP1

The crystal structure of NAP1 in complex with TBK1. Determined by X-ray diffraction at 1.45 Å resolution. Released 28 Sept 2016.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,599
Mol. weight: 24.37 kDa
Released: 28 Sept 2016

Explore 5EP6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EP6 contains 4 α-helices and 5 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
α-helix	216-246	31
β-strand	247	1	1
β-strand	248-249	2	2

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	680-714	35
β-strand	715-717	3	2

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	217-246	30

Chain D: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
α-helix	680-714	35
β-strand	715-717	3	2
β-strand	723	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5-azacytidine-induced protein 2	A, C	protein	47	Homo sapiens	Q9H6S1 (AlphaFold model)
Serine/threonine-protein kinase TBK1	B, D	protein	58	Homo sapiens	Q9UHD2 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5EP6_1 5-azacytidine-induced protein 2 (chains A, C)
SSDNMQHAYWELKREMSNLHLVTQVQAELLRKLKTSTAIKKENLYFQ

Sequence of entity 2 (B, D), FASTA

>5EP6_2 Serine/threonine-protein kinase TBK1 (chains B, D)
SGSGSYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL

Primary citation

Structural insights into the interaction and disease mechanism of neurodegenerative disease-associated optineurin and TBK1 proteins. Li, F., Xie, X., Wang, Y. et al. Nat Commun (2016) 7:12708-12708. DOI 10.1038/ncomms12708 · PubMed

Other PDB entries of the same protein (UniProt Q9H6S1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5Z7L 2.02 Å, Crystal structure of NDP52 SKICH region in complex with NAP1
7EA2 2.14 Å, crystal structure of NAP1 FIR in complex with RB1CC1 Claw domain
5Z7G 2.3 Å, Crystal structure of TAX1BP1 SKICH region in complex with NAP1
7EA7 2.69 Å, crystal structure of NAP1 LIR in complex with GABARAP

Browse structure collections

About this viewer

MolViewer shows 5EP6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.