5EPJ: Chromodomain of CBX7

Crystal Structure of chromodomain of CBX7 in complex with inhibitor UNC3866. Determined by X-ray diffraction at 1.6 Å resolution. Released 16 Dec 2015.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 572
Mol. weight: 7.61 kDa
Released: 16 Dec 2015

Explore 5EPJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EPJ contains 3 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	1
β-strand	13-22	10	2
β-strand	25-32	8	2
α-helix	37-39	3
β-strand	41-44	4	2
α-helix	45-47	3
β-strand	48	1	1
α-helix	51-59	9

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-4	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox protein homolog 7	A	protein	56	Homo sapiens	O95931 (AlphaFold model)
peptide-like inhibitor UNC3866	B	protein	6	Homo sapiens

Sequence of entity 1 (A), FASTA

>5EPJ_1 Chromobox protein homolog 7 (chains A)
GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE

Sequence of entity 2 (B), FASTA

>5EPJ_2 peptide-like inhibitor UNC3866 (chains B)
XFALXX

Primary citation

Crystal Structure of chromodomain of CBX7 in complex with inhibitor UNC3866. Liu, Y., Tempel, W., Walker, J.R. et al. To be published.

Other PDB entries of the same protein (UniProt O95931 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SII 1.37 Å, Crystal Structure of CBX7 with compound UNC4976
4MN3 1.54 Å, Chromodomain antagonists that target the polycomb-group methyllysine reader protein…
6V2R 1.6 Å, Crystal Structure of chromodomain of CBX7 mutant V13A in complex with inhibitor UNC3866
3GS2 1.7 Å, Ring1B C-terminal domain/Cbx7 Cbox Complex
9V9P 3.4 Å, Cryo-EM structure of the cPRC1-di-nucleosome (CBX7) complex
2K1B Solution NMR structure of the chromo domain of the chromobox protein homolog 7
2L12 Solution NMR structure of the chromobox protein 7 with H3K9me3
2L1B Solution NMR structure of the chromobox protein Cbx7 with H3K27me3

Browse structure collections

About this viewer

MolViewer shows 5EPJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.